DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and KFase

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001285676.1 Gene:KFase / 33907 FlyBaseID:FBgn0031821 Length:300 Species:Drosophila melanogaster


Alignment Length:126 Identity:29/126 - (23%)
Similarity:52/126 - (41%) Gaps:34/126 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 GEGR------YRGWHKPIPPSPSILFHCHGGGFVAQSSKSHELYLRDWAVALDCPILS------- 428
            ||||      |.  .|....:|..:| .|||            |.::..:::.|.|:.       
  Fly    61 GEGRQLVDVFYS--EKTTNQAPLFVF-VHGG------------YWQEMDMSMSCSIVGPLVRRGY 110

  Fly   429 ----VDYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAERVVCAGDSAGANLSIGVALK 485
                :||:|.|:....:.:.:..:...|:.:.||:  |....:..||.||||:|...:.::
  Fly   111 RVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEM--TKVSSLTFAGHSAGAHLLAQILMR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 29/126 (23%)
Abhydrolase 395..>539 CDD:304388 22/102 (22%)
Abhydrolase <767..827 CDD:304388
KFaseNP_001285676.1 Aes <67..297 CDD:223730 25/120 (21%)
Abhydrolase 82..276 CDD:304388 22/103 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.