DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and SPAC1039.03

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_594994.1 Gene:SPAC1039.03 / 2543023 PomBaseID:SPAC1039.03 Length:341 Species:Schizosaccharomyces pombe


Alignment Length:215 Identity:54/215 - (25%)
Similarity:83/215 - (38%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 DNLSSDVNQNQGDGDFV------EIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIP 389
            |.|.::.|...|..:.:      :|.:|..|......|..|:.   |..|...||   ||     
pombe    47 DFLRNNGNVMPGQSELLPVESTEDITIPRKHTKAPSGVPSRIF---RPHGTAPEG---GW----- 100

  Fly   390 PSPSILFHCHGGGFVAQSSKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLL 454
              |..|:. ||||:|..:..:...:.........|.:::|||.||||.|||..:.:.:.|..:..
pombe   101 --PCFLWF-HGGGWVLGNINTENSFATHMCEQAKCVVVNVDYRLAPEDPFPACIDDGWEALLYCY 162

  Fly   455 NNTELLGTTAERVVCAGDSAGANLSIGVALKCIEQGVRVP----DGLFLAYCPTLVSFVPSPARL 515
            .|.:.||....::...|.|||.|::..::.|........|    ..|.:..|....:.....:..
pombe   163 ENADTLGINPNKIAVGGSSAGGNIAAVLSHKVAASPANFPPLVLQLLVVPVCDNTANAKTHKSWE 227

  Fly   516 LCLMDPLLPFGFMMRCLRAY 535
            |....|.||...||...|.|
pombe   228 LFENTPQLPAAKMMWYRRHY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 11/50 (22%)
Aes 350..>537 CDD:223730 49/190 (26%)
Abhydrolase 395..>539 CDD:304388 38/145 (26%)
Abhydrolase <767..827 CDD:304388
SPAC1039.03NP_594994.1 Aes 55..341 CDD:223730 51/207 (25%)
Abhydrolase_3 103..313 CDD:285143 38/146 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102063
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.