DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and Aadacl2fm1

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_808329.1 Gene:Aadacl2fm1 / 229333 MGIID:3028051 Length:280 Species:Mus musculus


Alignment Length:431 Identity:81/431 - (18%)
Similarity:120/431 - (27%) Gaps:196/431 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 LRDW-AVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNTELLGTTAE--RVVCAGDSAGA 476
            |..| |..||..::.:||.|||:.|||.||::..|...:.|....|.....:  |:...|||:|.
Mouse     7 LNRWTANKLDAVVVGIDYRLAPKYPFPAALEDCVYTIKFFLQKNILAKYRVDPTRICIMGDSSGG 71

  Fly   477 NLSIGVALKCIEQGVRVPDGLFLAYCPTLVSFVPSPARLLCLMDPLLPFGFMMRCLRAYAAPAQE 541
            .|:..|.                                                          
Mouse    72 TLAATVT---------------------------------------------------------- 78

  Fly   542 TLQQNAKQVEDAAQIRNVPKSNVGSLNSSRRTSMARSPLSPLEASMNPDDESSDTFASASASYHS 606
            .|.||....:|..:                           .:|.|.|..:|.||...:...|. 
Mouse    79 QLLQNDPNFKDKIK---------------------------AQALMYPGLQSLDTLLPSHQEYQ- 115

  Fly   607 QTVERTDLPHTEGDNSSCVSFEDDSQPIVHYPIEISADPPKDTASAAYIDNFLDKYLIDTATMEV 671
                                         |.||                  ...:.:|..|.:.|
Mouse   116 -----------------------------HGPI------------------LTREMIIKLACLYV 133

  Fly   672 TEETAPEAVQAQA---NGHA--------KISSDDDILVET-GRDLVAIDTLQGRLQEAVNNITNT 724
            ||    :.|..||   |.|.        |..:..|.|.|. .::.|..:.:.|:|..        
Mouse   134 TE----DKVLLQAALRNEHMPTESRHLFKFVNWSDFLPEKYKKNYVYTEPILGKLNA-------- 186

  Fly   725 LTRCTQSYEIHGSNVMAQQDVRNMDALIARSPSEEFAFDVPKDPFLSPYWASDEWLSQLPETKIL 789
                                                ::.|..|..|||...:|..|..||.|.|:
Mouse   187 ------------------------------------SYPVLVDSRLSPLLFNDTQLQSLPLTYIV 215

  Fly   790 TLNMDPCLDDCVMFAKKLKRLGRQVDLEILEGLPHGFLNFT 830
            |...|...||.:::..:|:.:|.:|..|.:|...||.|:||
Mouse   216 TCEHDLLRDDSLIYISRLRNVGVKVTHEHIEKGIHGALSFT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 25/124 (20%)
Abhydrolase 395..>539 CDD:304388 25/126 (20%)
Abhydrolase <767..827 CDD:304388 21/59 (36%)
Aadacl2fm1NP_808329.1 Aes <4..267 CDD:223730 81/431 (19%)
Abhydrolase_3 4..251 CDD:285143 76/424 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.