DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and afmd-2

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_502605.2 Gene:afmd-2 / 189911 WormBaseID:WBGene00012866 Length:272 Species:Caenorhabditis elegans


Alignment Length:177 Identity:37/177 - (20%)
Similarity:66/177 - (37%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 ILFHCHGGGFVAQSSKSHELYLRDWAVALDCPILSVDYSLAPE-----APFPRALQEVYYAYCWL 453
            |:.|   ||:....::...|.:...|..|...::||.|..|.:     .....||:.|.:|....
 Worm    72 IMIH---GGYWLIGNRKKCLAVVHVAQKLGYTVVSVGYDYANKDHVLSKTIVEALEGVQFALKKF 133

  Fly   454 LNNTELLGTTAERVVCAGDSAGANLSIGVALKCIE---QGVRVPDGLFLAYCPTLVSF-----VP 510
            .|        |:::|..|.|.||:|:.....:..:   .|..:..|::.....|..::     :.
 Worm   134 KN--------AKKIVIGGHSVGAHLAFQAVTRIHDPRISGAYLSAGIYKIQELTSTTYGHDLGLT 190

  Fly   511 SPARLLCLMDPLL----PFGFMMRCLRAYAAPAQETLQQNAKQVEDA 553
            |.....|..|..|    .|..::.|.|..:....:..|..:.||.:|
 Worm   191 SEEAETCSCDYELMKHVRFPVLIACCRRESPKLYQQNQDFSSQVANA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906
Aes 350..>537 CDD:223730 33/159 (21%)
Abhydrolase 395..>539 CDD:304388 32/160 (20%)
Abhydrolase <767..827 CDD:304388
afmd-2NP_502605.2 Aes 26..>173 CDD:223730 25/111 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.