DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsl and F16F9.4

DIOPT Version :9

Sequence 1:NP_611463.1 Gene:Hsl / 37289 FlyBaseID:FBgn0034491 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_509437.1 Gene:F16F9.4 / 184575 WormBaseID:WBGene00017515 Length:396 Species:Caenorhabditis elegans


Alignment Length:251 Identity:53/251 - (21%)
Similarity:92/251 - (36%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 NISQNAKIDFCKSFWFLAESEMMHKLPSIVGSSI--KVNRLIE-----LPAEPLKLPRRKNFKAS 330
            :||..:|:...:....|:...:...:.::.|..:  ||.|.:.     :|..|.|...||..:..
 Worm    30 DISDRSKLTIAEFLMRLSNEYLGDLIENVFGPEVRNKVTRFVMGVGFLIPTLPPKRMIRKRIRIQ 94

  Fly   331 --DNLSSDVNQNQGDGDFVEIPVPTAHLGPGLPVSVRLLSARRRSGMLGEGRYRGWHKPIPPSPS 393
              ..::.::.:.|.||                                                 
 Worm    95 GVSCIAYEIEKPQNDG------------------------------------------------- 110

  Fly   394 ILFHCHGGGFVAQSSKSHELYLRDWAVALDCPILSVDYSLAPEAPFPRALQEVYYAYCWLLNNTE 458
            :|...||||:....::.::..:......:.|..:|:||.||||.|||..|.:.:.....:..|..
 Worm   111 LLIFIHGGGWCVGEARYYDGIMYQLCEQIGCNGISIDYRLAPEHPFPAGLDDCHAVVSEVCTNGL 175

  Fly   459 L-LGTTAERVVCAGDSAGANLSIGVALKCIEQGVRVPDGLFLAYCPTLVSFVPSPA 513
            | |....:||:.:|||||.||:..|..:...:...:..|..|.|..|.|....||:
 Worm   176 LDLPFNRKRVLISGDSAGGNLAAVVCQRLHREKKDILKGQILIYPVTHVFNFTSPS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HslNP_611463.1 HSL_N 51..376 CDD:283906 16/111 (14%)
Aes 350..>537 CDD:223730 37/165 (22%)
Abhydrolase 395..>539 CDD:304388 37/120 (31%)
Abhydrolase <767..827 CDD:304388
F16F9.4NP_509437.1 Aes 36..376 CDD:223730 51/245 (21%)
Abhydrolase_3 112..371 CDD:285143 37/120 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0657
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1263520at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.