DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9864 and SEO1

DIOPT Version :9

Sequence 1:NP_001261100.1 Gene:CG9864 / 37287 FlyBaseID:FBgn0034490 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_009333.1 Gene:SEO1 / 851230 SGDID:S000000062 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:447 Identity:92/447 - (20%)
Similarity:154/447 - (34%) Gaps:114/447 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 INLAIML-FMACL---LSYMMRVNL-SINIIAMVEDTSSHENG---TEVEALPDYGPRYNWTQSD 69
            |.|.::| |.:|:   :.|:..||: :..:..|.||.....|.   |:|                
Yeast   133 IKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQV---------------- 181

  Fly    70 QALLLGAYFYGYMITSLPAGTLAEMLGARNVAGYSCLVAGILTALTPAAAAWDKYA--VFAVRFL 132
                  .|..|.:|..||.......|....|.....|...:||    ..||:....  :.|:||.
Yeast   182 ------MYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLT----VGAAYVNSVPHLKAIRFF 236

  Fly   133 IGFLNGVVYPCCHSLVSKWSPPDEK---------GKFVASLMGGTFGTVITWPISGVIIENL-GW 187
            ||......|.....|...:...||.         |:::..|..|...:.:...::||  ..| ||
Yeast   237 IGAFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGV--NGLEGW 299

  Fly   188 DWAFYIVGIFVLVVVAIWFYLVADTPAQHSTISLKEREYIESSLGDTLSNKKKWPPYKELVLSLP 252
            .|.|.|..|..:||..|.||.:...|....:|.|.:.| |..:......|:.....::..|..:.
Yeast   300 RWNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDE-IRLARKRLKENQTGKSDFETKVFDIK 363

  Fly   253 FWSLMMLHYGSMWGLFFLITATPKFLSEVLGFNLSSAGFLSSLPHVARLLCAFGFGAVADWIRRR 317
            .|..:.    |.|.::.|.      |..:..:|.|:   :||             ||...|::..
Yeast   364 LWKTIF----SDWKIYILT------LWNIFCWNDSN---VSS-------------GAYLLWLKSL 402

  Fly   318 GWLSVTRMRKAFCLPSHILPGVMLIILAYFGRDPYVCVAIMTISLGFNGAATASNLANSQDLAPN 382
            ...|:.::.:.    |.|.||:.::.|...|                   ..|..|.:..     
Yeast   403 KRYSIPKLNQL----SMITPGLGMVYLMLTG-------------------IIADKLHSRW----- 439

  Fly   383 YAGTLYGIINCVGTTPGIFSPLIVAAFTKNENTIDQWHWVFIIGAAAYIL-PALFFW 438
            :|.....:.|.:|.:       |:||:...|..  :| :.|::....:.: |.|:.|
Yeast   440 FAIIFTQVFNIIGNS-------ILAAWDVAEGA--KW-FAFMLQCFGWAMAPVLYSW 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9864NP_001261100.1 2A0114euk 4..454 CDD:129972 92/447 (21%)
MFS 55..440 CDD:119392 78/397 (20%)
SEO1NP_009333.1 MFS_FEN2_like 134..548 CDD:340885 91/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.