powered by:
Protein Alignment CG9864 and C06E7.88
DIOPT Version :9
Sequence 1: | NP_001261100.1 |
Gene: | CG9864 / 37287 |
FlyBaseID: | FBgn0034490 |
Length: | 465 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255275.2 |
Gene: | C06E7.88 / 13194964 |
WormBaseID: | WBGene00189995 |
Length: | 167 |
Species: | Caenorhabditis elegans |
Alignment Length: | 54 |
Identity: | 12/54 - (22%) |
Similarity: | 21/54 - (38%) |
Gaps: | 5/54 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 IFVLVVVAIWFYLVADTPAQHSTISLKEREYIESSLGDTLSNKKKWPPYKELVL 249
:.:||:..:...:.....::|....| |....||:...||...|.|..:|
Worm 5 VIILVICLVGLPVAFGLESKHWQWRL-----ISCKAGDSPVQKKDASPCKVSLL 53
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9864 | NP_001261100.1 |
2A0114euk |
4..454 |
CDD:129972 |
12/54 (22%) |
MFS |
55..440 |
CDD:119392 |
12/54 (22%) |
C06E7.88 | NP_001255275.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2532 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.