DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9864 and C06E7.88

DIOPT Version :10

Sequence 1:NP_611462.1 Gene:CG9864 / 37287 FlyBaseID:FBgn0034490 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001255275.2 Gene:C06E7.88 / 13194964 WormBaseID:WBGene00189995 Length:167 Species:Caenorhabditis elegans


Alignment Length:54 Identity:12/54 - (22%)
Similarity:21/54 - (38%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 IFVLVVVAIWFYLVADTPAQHSTISLKEREYIESSLGDTLSNKKKWPPYKELVL 249
            :.:||:..:...:.....::|....|     |....||:...||...|.|..:|
 Worm     5 VIILVICLVGLPVAFGLESKHWQWRL-----ISCKAGDSPVQKKDASPCKVSLL 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9864NP_611462.1 MFS_SLC17 16..441 CDD:340876 12/54 (22%)
C06E7.88NP_001255275.2 None

Return to query results.
Submit another query.