DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and asic1a

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_021333995.1 Gene:asic1a / 791696 ZFINID:ZDB-GENE-040513-2 Length:614 Species:Danio rerio


Alignment Length:501 Identity:108/501 - (21%)
Similarity:175/501 - (34%) Gaps:144/501 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YGLSR-FIWSSVLLQLLLLSIY----LTLLLW-----LKFY-SYPILNTISNDLSITDVAFPGVT 112
            :|:|. |.:..:..:..|..::    ||.|::     ::|| .||.:..: ::::...:.||.||
Zfish   146 HGISHIFSYEKITAKCCLWVVFFLSSLTFLMYVCIDRIQFYLEYPHVTKL-DEITTPVMVFPAVT 209

  Fly   113 ICSPKVVNSERVDRYVKTLKIPKEYDMAEVIA-----------------GFDFLNAFTD-QSFEP 159
            ||:   :||.|..|..:.    ..|...|::|                 ..:.|.:.|| :||:|
Zfish   210 ICN---LNSIRFSRITRN----DLYHAGELLALLNSRHEVREAHLVEESVMEVLKSKTDFRSFKP 267

  Fly   160 PGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRC-FWGHTEFQCNQSHEYLSFIPTTAYLG 223
                           .:.::||..........|.:..| |.|.   .|......:.|   |.| |
Zfish   268 ---------------RHFNMWEFYNRTGHDIKDMLLSCQFRGS---PCRPEDFSVVF---TRY-G 310

  Fly   224 PCCSFNYNPRNASFVPFSANIFGMDGGLTF-----------VGAEGSERNLNTGLIVLVHHPMD- 276
            .|.:||........|....   ||..||..           |..|..|.:...|:.|.:|...: 
Zfish   311 KCYTFNSGETGPPRVSVKG---GMGNGLEIMLDIQQDEYLPVWGESDESSFEAGIKVQIHSQDEP 372

  Fly   277 -YVTEAAASVT------ITAQSESFVEVSPTVQSSSVEVLELSERKRDCLISGDLQLSNYRQAAC 334
             ::.:....|.      ::.|.:..|.: |....|.......|:..|           .|..:||
Zfish   373 PFIDQLGFGVAPGFQTFVSCQEQRLVYL-PAPWGSCKSTPPSSDYFR-----------AYSISAC 425

  Fly   335 LLACQTEAIVKKCGCH--------PYLLPIVGNKFKEC---------NLNDTFCYSANYDNFKSV 382
            ...|:|..:|:.|.|.        ||..|::   :|||         ..:..:|           
Zfish   426 RTDCETRYLVENCNCRMVHMPGDAPYCTPVL---YKECAHPALDFLVETDSDYC----------- 476

  Fly   383 RCDQCLPNCYDVTYS-TLSY-----KTDLN--QHKYSVSRFYSPELLNNDSFVLRVYLAKQVVPV 439
               .|...|....|| .||:     |..:.  ..|||.|..|    :..:..||.|:........
Zfish   477 ---SCETPCNITRYSKELSFVKIPSKASVKYLAKKYSKSEKY----ITENVMVLDVFFEALNYET 534

  Fly   440 IRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYY----CTYRL 481
            |.:.......|||.|:||...|.:|.|:::::|.|.|    ..|||
Zfish   535 IEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVMKYRL 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 97/459 (21%)
asic1aXP_021333995.1 ASC 136..582 CDD:322155 108/501 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.