DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ASIC4

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_061144.4 Gene:ASIC4 / 55515 HGNCID:21263 Length:539 Species:Homo sapiens


Alignment Length:506 Identity:108/506 - (21%)
Similarity:184/506 - (36%) Gaps:112/506 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKRGKDPSLIRTAI-------LATFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSI 78
            ::.|.:.||:....       ||||   ...:.:.|:........:||.|.:|:..||..|...:
Human    21 KEAGDEQSLLGAVAPGAAPRDLATF---ASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFL 82

  Fly    79 YLTLLLWLKFYSYPILNTISNDLSITDVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVI 143
            |....|...:.:.|.|..:..........||.||:|:        ::|:           ....:
Human    83 YQAAGLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCN--------INRF-----------RHSAL 128

  Fly   144 AGFDFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRC-FWGHTEFQCN 207
            :..|..:........|...|.:||  |.||.....:.:..........|.:|.| |.||   .|:
Human   129 SDADIFHLANLTGLPPKDRDGHRA--AGLRYPEPDMVDILNRTGHQLADMLKSCNFSGH---HCS 188

  Fly   208 QSHEYLSFIPTTAYLGPCCSFNYNPRNASFVPFSANIFGMDGGLTF-----------VGAEGSER 261
            .|:..:.:   |.| |.|.:||.:||  |.:|..|.  ||..||..           :..|.:|.
Human   189 ASNFSVVY---TRY-GKCYTFNADPR--SSLPSRAG--GMGSGLEIMLDIQQEEYLPIWRETNET 245

  Fly   262 NLNTGLIVLVHHPMD--YVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRDCLISGDL 324
            :...|:.|.:|...:  |:.:....|:...|:        .|......:..|.:...:|....:|
Human   246 SFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQT--------FVSCQEQRLTYLPQPWGNCRAESEL 302

  Fly   325 Q------LSNYRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNLNDTFCYSANYDNFKSVR 383
            :      .|.|..:||.|.|:.||::::|.|....:|  |        |:|.|....|     :.
Human   303 REPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMP--G--------NETICPPNIY-----IE 352

  Fly   384 C-DQCLPN--------CYDVTYSTLS-YKTDLNQ-------------HKYSVSRFYSPELLNNDS 425
            | |..|.:        |:..|...|: |..:::.             .||:.:..|    :..:.
Human   353 CADHTLDSLGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETY----IRENF 413

  Fly   426 FVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYY 476
            .||.|:........:.:........||.||||...|.:|.|:::::|...|
Human   414 LVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILDY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 90/433 (21%)
ASIC4NP_061144.4 ASC 40..488 CDD:413546 105/487 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.