DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk21

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster


Alignment Length:557 Identity:121/557 - (21%)
Similarity:211/557 - (37%) Gaps:125/557 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKRGKDPSLIRT-------AILATFW--------EYTERTKVSGMWLMR--RNRTYGLSRFIWSS 68
            |..|....||:|       :.|...|        :|...:.|.|:..:.  :.|.|...|.||..
  Fly    16 RDYGGKSGLIQTQRDARKNSRLGKLWHFMLPYLKDYAAESSVHGIRYLADPKMRNYLNIRVIWLL 80

  Fly    69 VLLQLLLLSIYLTLLLWLKFYSYPILNTISND-LSITDVAFPGVTIC-----SPKVVNSERVDRY 127
            :||...:.:|.:.:.|...:.:..|..||.|. |.|..:.||.:.:|     :.|::.:|.||.:
  Fly    81 ILLTTSIGAIVVYVDLNELYQTVRIQTTIKNTMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHF 145

  Fly   128 VKTLKIPKEYDMAE---VIAGFDFLNAFTDQS--FEPPGHDSYRATDAVLRLNNVSIWEAAMAVS 187
            :.......:.|:..   ..||...|:...:.|  |   |:.:  .||.:..|:::.:.|....:.
  Fly   146 LGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNFF---GNKT--LTDELHMLDHLDLREVYKFIQ 205

  Fly   188 PGCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFN--------YNPRNASFVPFSANI 244
            ..|.|....|.|......|.:..|| .|  |.|  |.|..||        ...|...:.|.....
  Fly   206 FRCQDLFHTCRWRGNPVNCCEVIEY-QF--TEA--GLCFVFNTEISPASRQKAREDKYYPLRTPH 265

  Fly   245 FGMDGGL--------TFVGAEGSERNLNTGLIVLVHHPMDYVT-------EAAASVTITAQSESF 294
            :|...||        :|:      |....|:.|::..|..:..       ||...::||.:   |
  Fly   266 YGEGSGLDLFLRLNRSFI------RPGKRGINVMIKQPQQWSDVVRHVPHEAHTRISITPR---F 321

  Fly   295 VEVSPTVQSSSVEVLELSERKRDCLISGDLQLSNYRQ--------AACLLACQTEAIVKKCGCHP 351
            .......::.:.|:       |.|:...::...:|:.        ..|...|..|.::..|.|.|
  Fly   322 TVTDERTRTVTPEI-------RRCIFGDEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKCSP 379

  Fly   352 YLLPIVGNK--FKECNLNDTFCYSANYDN-------------------FK-SVRCDQCLPNCYDV 394
            .:...:.:|  |..|..:|..|.   |||                   || |:.|| |..:|..:
  Fly   380 SIFFPISDKDNFTACKASDFKCL---YDNRFTFSIERHPEEDDFVKNPFKESMICD-CFTSCSQL 440

  Fly   395 TYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFVLRVYLAKQVVPVIRKVTVM--SWIGLLSDLGG 457
            .:..:...|.|:.::           .:.::..:|:.:..|....|:..|.|  :::.||:..||
  Fly   441 VFDRVFTTTTLDNNE-----------TDTEAGTMRLDIFYQSGWFIQYQTNMRFTFVELLASFGG 494

  Fly   458 IFNLCLGLSMISVVEFFYYCTYRLYIN-YQLQKVQQP 493
            |..|.||.|::|..|..||.:..||:. :..:|:::|
  Fly   495 IIGLFLGASLLSAFELAYYFSIGLYLYIHGKRKLRKP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 96/456 (21%)
ppk21NP_651704.2 ASC 51..513 CDD:279230 108/502 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112386at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.