DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and asic1c

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_021325802.1 Gene:asic1c / 407670 ZFINID:ZDB-GENE-040513-3 Length:562 Species:Danio rerio


Alignment Length:507 Identity:115/507 - (22%)
Similarity:182/507 - (35%) Gaps:144/507 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RTKVSGM---WLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLL---W---LKFYSYPILNTI-- 97
            ||||.|:   :...:::|   .|..|      ||.|.:.|.||.   |   |...|||.:..|  
Zfish    44 RTKVHGLKHAFSPHKSKT---QRLFW------LLALLVCLGLLFTWSWNRILYLLSYPAVTKIYM 99

  Fly    98 --SNDLSITDVAFPGVTICSP---KVVNSERVDRY-------------------VKTLKIPKEYD 138
              ||:::     ||.:|.|:.   :|.:..|.|.|                   |..||..:..:
Zfish   100 VWSNNMT-----FPAITFCNQNRLRVSSLTRDDLYYSGYWMDILHLNHTLNRQSVSMLKHSRHRE 159

  Fly   139 MAEVIAGFDFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRC-FWGHT 202
              .::...||      ..:.||...|...|:.:.||.:            ...|.:..| |.|. 
Zfish   160 --RLLHLLDF------SHYSPPPDQSLNTTEMIDRLGH------------QLQDMLLECRFRGE- 203

  Fly   203 EFQCNQSHEYLSFIPTTAYLGPCCSFNYNPRNASFVPFSANIFGMDGGLTFVGAEGSERNLNTGL 267
              .|.    |.:|.|.....|.|.:||               .|:||.......:|...|   ||
Zfish   204 --NCT----YKNFTPIYTRYGKCYTFN---------------SGLDGNPLLTTLKGGTGN---GL 244

  Fly   268 IVLVHHPMD-YVT----------EAAASVTITAQSE-SFVE-----VSPTVQS----SSVEVLEL 311
            .:::....| |:.          ||...|.|.:|.| .|::     |:|..|:    ....:|.|
Zfish   245 EIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLLYL 309

  Fly   312 SERKRDCLISGDLQ---LSNYRQAACLLACQTEAIVKKCGCHPYLLP-----IVGNKFKECNLND 368
            .....||. |..:.   .|.|...||.:.|:|..:::.|.|....:|     ....::|:| .:.
Zfish   310 PPPWGDCR-SAPMDSEYFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDC-ADP 372

  Fly   369 TFCYSANYDNFKSVRCDQCLPNCYDVTYSTLSYKTDLN--------QHKYSVSRFYSPE-LLNND 424
            ...:....||      |.|:  | |...:...|..:|:        ..||...:|...| .:.::
Zfish   373 ALDFLVEKDN------DYCV--C-DTPCNMTRYGKELSMVKIPSKASAKYLAKKFNKTEQYITDN 428

  Fly   425 SFVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYY 476
            ..||.::........|.:.......|||.|:||...|.:|.|:::::|.|.|
Zfish   429 ILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFDY 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 100/458 (22%)
asic1cXP_021325802.1 ASC 34..531 CDD:322155 115/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.