DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and asic4b

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:485 Identity:96/485 - (19%)
Similarity:173/485 - (35%) Gaps:119/485 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDLSITDVAFPGVTICSPKVVNSERV 124
            |..:.:|...||..|.|.:|........:...|.|..:..: :..::.||.:|:|:        |
Zfish    67 GFRQTLWGLALLVSLGLFLYQATWSAATYLERPHLAALREE-TRRELTFPAITLCN--------V 122

  Fly   125 DRY-VKTLKIPKEYDMAEVIAGFDFLNAFTDQS----------FEPPGH-DSYRATDAVLRLNNV 177
            :|: ...|.....|.:|.       |.....:|          :.||.. |.::.|...|.    
Zfish   123 NRFRFSALTDADIYHLAN-------LTGLPPKSRKGHRPSELQYPPPNMLDIFQRTGHQLE---- 176

  Fly   178 SIWEAAMAVSPGCFDYVKRC-FWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFNYNPRNASFVPFS 241
                          |.:|.| |.|.     |.|.|..|.:.|.  .|.|.:||.|..:    |..
Zfish   177 --------------DMLKSCNFSGQ-----NCSSEDFSVVYTR--YGKCYTFNGNKTS----PKR 216

  Fly   242 ANIFGMDGGLTF-----------VGAEGSERNLNTGLIVLVHHPMD--YVTEAAASVTITAQSES 293
            ....|...||..           :..|.:|..|..|:.|.:|...:  |:.:....|:...|:  
Zfish   217 VRQGGTGNGLEMMLDIQQDEYLPIWRETNETTLEAGIRVQIHSQNEPPYIHQLGFGVSPGFQT-- 279

  Fly   294 FVEVSPTVQSSSVEVLELSERKRDCLISGDLQL---SNYRQAACLLACQTEAIVKKCGCHPYLLP 355
                  .|......:..|.:...:|..|.:..:   ..|..:||.|.|::..:.::|.|....:|
Zfish   280 ------FVSCQEQRLTYLPQPWGNCRASSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMP 338

  Fly   356 IVGNKFKECNLNDTFCYSANYDNFKSVRC-DQCLPNCYDVTYSTLSYKTDLNQHKYS-------- 411
              |:.        ..|..:      .::| |:.|.:....|..:...:|..|..:|.        
Zfish   339 --GDA--------DICAPS------KIKCVDKALASLQKSTGDSCPCETPCNLTRYGKELSMVKI 387

  Fly   412 --------VSRFY--SPELLNNDSFVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLS 466
                    :||.|  |.|.:.::..:|.::........|.:.......|||.|:||...|.:|.|
Zfish   388 PSRGSARYLSRKYQKSEEYIRDNFLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGAS 452

  Fly   467 MISVVEFFYYCTYRLYINYQLQKVQQPRKA 496
            :::::|...| .|.:..| :::::.:|:|:
Zfish   453 ILTILEILDY-IYEVAKN-KIKQLLKPKKS 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 84/438 (19%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 96/485 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586597
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.