DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk17

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:503 Identity:100/503 - (19%)
Similarity:167/503 - (33%) Gaps:151/503 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDLS 102
            :|..|.      .||.|....  |.|::   ||....::.|......:.|.|:.||.......|:
  Fly     3 YWSETR------AWLFRDPAK--LIRYL---VLFACCIVVIVQLYECFAKLYNPPISTHSYYSLN 56

  Fly   103 ITDVAFPGVTICSPKVVNSERVDR-------YVKTLKIPKEYDMAEVIAGFDFLNAFTDQSFEPP 160
            .| :..|.||||.......|.:.|       :.|......:|...|:         ..|:.||..
  Fly    57 ET-IEMPSVTICREPPYKEEVLTRLSGGACPHPKYATCWMKYPFGEI---------SLDEFFENS 111

  Fly   161 GHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRCFWGHTEFQCN-QSHEYLSFIPTTAYLGP 224
            .|||   .|..:                         |:|..|.:.| ..:..|.|     |:|.
  Fly   112 THDS---GDTFV-------------------------FYGLNEDKNNVVMNSSLHF-----YMGR 143

  Fly   225 CCSFNYNPRNASFVPFSANIFGMDGGLTFVGAEGSER-NLNTGLIVLVHHPMDYVTEAAASVT-- 286
            |  :...|:                       |.::| :...|..:::.|.|  :|.:.:.|.  
  Fly   144 C--YTLRPK-----------------------ESAKRVSKAVGYSIMLEHSM--LTTSVSDVDTG 181

  Fly   287 -------ITAQSESFVEV----SPTVQSSSVEVLELSERKRDCLISGDLQL--------SNYRQA 332
                   |..:.|:|.|:    |..|:...|.|.|..|.|.......::|.        .||...
  Fly   182 SVGWHVFIHDKKENFTEINMKGSGRVEYVFVGVNEEIEIKLQTQYFSNVQTREEACSDDENYSDL 246

  Fly   333 ACLLACQTEAIVKKCGCH-PYLLPIVGNKFKECN--------LNDTFCYSANYDNFKSVRCDQCL 388
            .|...|..:.:.....|. |::..|..   :.||        ::|   |...|:|.....|| |:
  Fly   247 KCGEQCIWQDLADNMQCSGPWMHEIAS---EPCNDSLSMRKLISD---YKDVYENEDDFDCD-CV 304

  Fly   389 PNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFVLRVYLAKQVVPVIRKVTVMSWIGLLS 453
            ..|....|:|.     :...|    .|..||....    :.:|...:::.:|.:.........::
  Fly   305 QPCQSRIYTTF-----IQNRK----AFNQPEPRTQ----IYIYYTTKLISMIEERPSYDTTQFIA 356

  Fly   454 DLGGIFNLCLGLS---MISVVE--FFYYCTYRLYINYQLQKVQQPRKA 496
            |:||.....||||   :|.::|  ..::|      ...::::||..:|
  Fly   357 DVGGSLGFLLGLSVLGLIGILEHMMLFFC------GGFIKRMQQKEQA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 86/434 (20%)
ppk17NP_001285988.1 ASC 11..358 CDD:295594 84/441 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.