DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk11

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster


Alignment Length:513 Identity:114/513 - (22%)
Similarity:188/513 - (36%) Gaps:145/513 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KNSKGDGSRKRGKDPSLIRTAILATFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLS 77
            :|..|...||.|             |..|.|...:.|..:....:|:  .|.:|..::...:|||
  Fly    81 RNDDGLCKRKTG-------------FEIYCEMASIHGFHIFVGAKTW--QRILWWLLICNAVLLS 130

  Fly    78 IYLTLLLWLKFYSYPILNTISNDLSIT-DVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAE 141
            ..|.::........|.:..|...:..| :|.||.||||                           
  Fly   131 FTLVIMSLSMSKETPTIRFIDTMMKPTAEVPFPAVTIC--------------------------- 168

  Fly   142 VIAGF---DFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIW-----EAAMAVSPGCFDYVKRCF 198
               ||   :::|                 :..::...|.| |     :.|:.:.|    .:|.|.
  Fly   169 ---GFNTKEWMN-----------------SSQIVNQRNAS-WLELLEDLALPICP----QIKICQ 208

  Fly   199 WGHTEFQCNQSHEYLSFIPTTAYLGP--------CCSFNYNPRNASFVPFSANIFGMDGGLTFVG 255
            |.:....|...            |.|        |||||||.:          :|....|::||.
  Fly   209 WDNRMVNCLDQ------------LQPIWTLDQRLCCSFNYNKQ----------LFSSYLGVSFVL 251

  Fly   256 AEGSE---RNLNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRD 317
            ....|   .:.:.|..||:|...:....|...|.:..:|::.:.:.|.:...:..:..||.:||.
  Fly   252 RSNDEILQSSKSAGFEVLIHESHEIPNGATPRVFVPGESDAHIMLRPYINRFTKNLKGLSLQKRG 316

  Fly   318 CLISGD--LQLSN-YRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNLNDTFCYSANYDNF 379
            |..|.:  |.||: |.|..||..|:||:|:|.|||.|...|| ...:..|:|....|. .::|:.
  Fly   317 CYFSTERRLILSDVYNQINCLAECRTESILKSCGCIPPKSPI-EKSWLICDLKQMQCV-IDFDHD 379

  Fly   380 KSV-----RCDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFV------------ 427
            :.:     .|| |||.|            :.|::::.....:...::|| |.|            
  Fly   380 EIISGEQKNCD-CLPPC------------EFNRYEFQSDIRFIKGMINN-SIVNTSNQETTNEVR 430

  Fly   428 LRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYCTYRLYINY 485
            :|||....:...:......:|:..:...|||..|.:|.|.:||.|..::...|...|:
  Fly   431 VRVYYDSAIAEELLLDVYENWLTFIGTFGGITGLFMGCSFVSVFELIFFSCVRPTCNW 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 96/430 (22%)
ppk11NP_001334672.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.