DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk31

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001097944.1 Gene:ppk31 / 318575 FlyBaseID:FBgn0051065 Length:421 Species:Drosophila melanogaster


Alignment Length:454 Identity:95/454 - (20%)
Similarity:172/454 - (37%) Gaps:108/454 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLLLSIYLTLLLWLKFYSYPILNT-ISNDLSIT--------DVAFPGVTICSPKVVNSERVDRYV 128
            |.|::.|.||..:.. .|..:||: :|:.:|..        :..||.:|:|  ::.|:||:    
  Fly     5 LYLVTFYHTLPFFAN-VSLSLLNSYLSSSVSFNLDTIYLNWNSTFPAITVC--EIYNAERI---- 62

  Fly   129 KTLKIPKEYDMAEVIAGFDFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDY 193
                    :|:::...|.:              ||.: ..|.:   :.:..:.   .|...|.|.
  Fly    63 --------WDLSDSNFGVE--------------HDMH-VDDFI---SEIVFYR---GVCSSCEDC 98

  Fly   194 VK-RCFWGHTEF------QCNQ---SHEYLS--------FIPTTAYLGPCCSFN-YNPRNASFVP 239
            .: ||....|..      :|:|   :..||:        |:|.....|.|.||| :..|..|.:.
  Fly    99 SRMRCPSNFTHLVDVFRTKCHQLLVNCTYLNKLFDCCDQFLPLPTEYGLCFSFNSHQARKVSHLQ 163

  Fly   240 FSANIFGMDGGLTFVGAEGSERNLNTGLIVLVHHPMDYVTEAA-----ASVTITAQSESFVEVSP 299
            |:.|.....|.|:|..|        ..:.:.||.|:|...:.:     .:|.:....|..:.|..
  Fly   164 FTNNRMTGPGHLSFHAA--------ADIQLYVHAPIDVPYQFSEGMIRETVLLGHYKELILNVIE 220

  Fly   300 TVQSSSVEVLELSERKRDCLISGDLQLSN------YRQAACLLACQTEAIVKKCGCHPYLLPIVG 358
            .....||:  :||..:|.|....:.....      |..:.|::.|.....:..|.|..:.:.|.|
  Fly   221 VHNDESVQ--DLSMEQRRCRYGHEHVPERQGIYDFYSYSGCVVECTVLLQLDNCNCTSHFMAIPG 283

  Fly   359 -NKFKECNLNDTFCYSANYDNFKSVR--CDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPEL 420
             |....|::....|.:...|...:.|  | :|:.:|.:..|:.:....|            ..:.
  Fly   284 QNYLPVCDVRGLICLTRIRDKIMTERKSC-ECMSSCEEPEYNIIYNSAD------------EDDE 335

  Fly   421 LNNDSFVLRVYLAKQVVPV---IRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYC-TYR 480
            .:::...:||.|.:  :|.   :|:|| .:.:..|..|||:..|....|.:.:||....| .||
  Fly   336 ASDEVSEIRVALVE--LPTQRYVRRVT-KTILDFLISLGGLVGLFFNTSALRIVETIVICLRYR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 87/435 (20%)
ppk31NP_001097944.1 ASC <127..387 CDD:279230 60/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.