DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk8

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001036260.3 Gene:ppk8 / 318213 FlyBaseID:FBgn0052792 Length:569 Species:Drosophila melanogaster


Alignment Length:531 Identity:113/531 - (21%)
Similarity:204/531 - (38%) Gaps:120/531 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDL-SI 103
            |:...|.:.|:..:..::.....|..:...||.:|.|:|||....:.|:.:.|::..|..:| ||
  Fly    41 EFCRNTTIHGLKYINNSKLRSSDRLFFGIALLVVLSLAIYLIQDAFDKWNTNPVIVGIDPELTSI 105

  Fly   104 TDVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVIAGFDFLNAFTDQSFEPPGHDSYRAT 168
            .:..||.||||:.....:|||:.:...   ..|:.|.:::.                    .|..
  Fly   106 ANEPFPAVTICNLNQALAERVEHFSND---SVEFAMLQLLC--------------------RRKV 147

  Fly   169 DAVLRLNNVSIWEA-AMAVSPGCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFN--- 229
            |..|...|.|.||. .:.:|..|...|..|.:|..:::|.:     .|.|.....|.||.||   
  Fly   148 DVELVKTNDSRWEEFILNISQPCNSMVIHCRFGADDYECAR-----LFHPIVTDEGLCCVFNMLH 207

  Fly   230 ----YNPRNASFVPFSANIFGMDGGLTFVG------------------------AEGSERNL--- 263
                |..|    ||:|.....:..|...|.                        |:|:..:|   
  Fly   208 PRFMYRKR----VPYSHRNISLPEGFHAVNWHAELGYRKRGFQPDGDNPLYPRRAQGTGESLGLS 268

  Fly   264 ----------------NTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELS 312
                            :.|..:.:|.|.:........|.:....|:.:.:.|:...:...:..:.
  Fly   269 LTLDVQADAYYCSSSSSIGFKIALHSPNESPNVRETGVLLAPGMETKLRIDPSKILTEKHLRNVD 333

  Fly   313 ERKRDCLISGDLQL---SNYRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNLNDTFCYSA 374
            .|.|.||...:|:|   ::|.|..|:..|.:..:::.|||..:.:|       ..|.|||.|...
  Fly   334 RRSRRCLFHNELKLRWFAHYTQRNCVAECLSGWLIRHCGCVTFYMP-------RLNANDTICPLH 391

  Fly   375 NYDNFKSVR---------C-DQCLPNCYDVTYSTLSYKTDLNQHKYSVSRF----------YSPE 419
            ..:..:.:|         | |:|||:|:|:::|.::|.|     :.|:..|          ::..
  Fly   392 KRECVELIRFRTIIAMESCLDECLPSCFDLSFSAIAYST-----RISLDGFRETPSNGGWNFTDA 451

  Fly   420 LLNNDSFVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYCTYR-LYI 483
            .:.....|:.:|.........::...:.:...||.:||:..|.||.|.:|:.|..|:...| ...
  Fly   452 YVERSVAVVNMYFKDPTFRANKQTEFIGFSDFLSGVGGLMGLFLGFSFLSIAECVYFALIRPCRT 516

  Fly   484 NYQLQKVQQPR 494
            ..:::::.|||
  Fly   517 CSEIRQLNQPR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 97/465 (21%)
ppk8NP_001036260.3 ASC 42..508 CDD:279230 107/509 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112386at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
65.850

Return to query results.
Submit another query.