DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and ppk25

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster


Alignment Length:501 Identity:104/501 - (20%)
Similarity:177/501 - (35%) Gaps:96/501 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGSRKRGKDPSLIRTAILATFW--EYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSIYL 80
            :....|.|.|.          |  |..:.:.:.||..:.|...:...|..|:.::|.....:|..
  Fly     2 ESKMSRPKQPD----------WLAELCQESSIHGMPYIARRDLHWAERLFWTFIILGSAYYAISS 56

  Fly    81 TLLLWLKFYSYPILNTISNDLSITDVAFPGVTICSPKVVNSERVDRYV-KTLKIPKEYDMAEVIA 144
            .|..|.:|...||:........:....|.|:|:| |:..:...:.|.: :|..:....|..:.:.
  Fly    57 CLNQWYRFRDNPIVYEYEYLFGLRIFPFVGITLC-PRYHDETEIPRLINQTWGVDPSEDKEKAVY 120

  Fly   145 GFDFLNAF------TDQSFEPPGHDSYRATDAVLRLNNVSIWE---AAMAVSPGCFDYVKRCFWG 200
            ...||.|.      |.::.||..:|:  ..|.|..||.:...:   .|:.:.|.....:......
  Fly   121 YRKFLLAINGLRYSTLETLEPFENDT--TLDNVNYLNILLTLQKKVIAVKIPPELAPIITEVGLC 183

  Fly   201 HTEFQCNQSHEYLSFIPT--------TAYLGPCCSFNYNPRNASFVPFSANIFGMDGGLTFVGAE 257
            .|..|.|:.......:.|        ..||..|.: :..|.|:...|....:..::         
  Fly   184 QTSSQLNRYGNPYGKLETQDMEPMKQCGYLSNCIT-SLKPINSIVAPIFMYLHDVE--------- 238

  Fly   258 GSERNLNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRDCLISG 322
              |..|          |.|..|.:..:..|.::.   :::.....|:..||..|....|.|..|.
  Fly   239 --EMML----------PDDMRTPSFDAKDIESKD---LDIMLHTTSAESEVRNLPVAYRKCRFSD 288

  Fly   323 DLQL---SNYRQAACLLACQTEAIVKKCGCHPYL------LPIVGNKFKECNLNDTFCYSANYDN 378
            :..|   |.|..:.|.|.|:.:..:..|.|.||.      :||       |.::...|.:.:  .
  Fly   289 ENNLQYYSPYHPSLCRLECRIKWALSLCNCKPYFYVAAPEVPI-------CTVSGMLCLARS--K 344

  Fly   379 FKSVRCDQCLPNCYDVTYSTLSYKTDL-NQHKYSVSRFYSPELLNNDSFVLRVYLAKQVVPVIRK 442
            :....|| |.|:|.:.|::........ ....||..||....::|..  :.|:.:.::|      
  Fly   345 WLERPCD-CYPSCREETFTIFKVSDQTGGDDNYSGERFERTLIINLQ--ISRMGINRRV------ 400

  Fly   443 VTVMSWIGLLSDLGGIFNLCLGLSMIS---VVEFF-----YYCTYR 480
              |.|...|:...||...|.||.|.::   ||.||     |.|..|
  Fly   401 --VFSTDQLIMSFGGAIGLFLGASFMTIYGVVYFFLTFIAYTCKNR 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 88/426 (21%)
ppk25NP_995766.1 ASC 18..432 CDD:279230 94/461 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.