DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and Asic2

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:565 Identity:121/565 - (21%)
Similarity:191/565 - (33%) Gaps:177/565 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PGKKNS-----KGDGSRKRGKDPSLIRTAILATFWEYTERTKVSG------MWLMRRNRTYGLSR 63
            ||...|     :|.|..:||: |||.||.:.........||...|      :|::....:.|| .
  Rat    38 PGGDRSGDPALQGPGVARRGR-PSLSRTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGL-L 100

  Fly    64 FIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDLSITDVAFPGVTICSPKVVNSERV---D 125
            ..|||           ..||.||   |:|....:..:.| ..:.||.||:|:...:...|:   |
  Rat   101 LSWSS-----------NRLLYWL---SFPSHTRVHREWS-RQLPFPAVTVCNNNPLRFPRLSKGD 150

  Fly   126 RYVK----TLKIPKEYD---MAEVIAGFD-----FLNAFTDQSFEPPGHDSYRATDAVLRLNNVS 178
            .|..    .|.:|....   ::|::.|.:     |......:.|.||.|                
  Rat   151 LYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQWFRKLADFRLFLPPRH---------------- 199

  Fly   179 IWEAAMAVSPGCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFNYNPRNASFV----- 238
                        |:.:...|....      .|:....:.:..|.|..|    .|.|.|.|     
  Rat   200 ------------FEGISAAFMDRL------GHQLEDMLLSCKYRGELC----GPHNFSSVFTKYG 242

  Fly   239 ---PFSANIFGMDGGLTFVGAEGSERNLNTGLIVLVHHPMD-YVT----------EAAASVTITA 289
               .|::   |.||.......:|...|   ||.:::....| |:.          ||...|.|.:
  Rat   243 KCYMFNS---GEDGKPLLTTVKGGTGN---GLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHS 301

  Fly   290 QSE-SFVE-----VSPTVQSSSVEVLELSERKRDCLIS--GDLQLSN--------YRQAACLLAC 338
            ||| .|::     |:|..|:    .:...|::...|..  |:.:.|.        |...||.:.|
  Rat   302 QSEPPFIQELGFGVAPGFQT----FVATQEQRLTYLPPPWGECRSSEMGLDFFPVYSITACRIDC 362

  Fly   339 QTEAIVKKCGCH--------PYLLPIVGNKFKEC---------NLNDTFCYSANYDNFKSVRCDQ 386
            :|..||:.|.|.        |:..|   .:.|||         ..:..:|.              
  Rat   363 ETRYIVENCNCRMVHMPGDAPFCTP---EQHKECAEPALGLLAEKDSNYCL-------------- 410

  Fly   387 CLPNCYDVTYS------TLSYKTDLNQHKYSVSRF-YSPELLNNDSFVLRVYLAKQVVPVIRKVT 444
            |...|....|:      .:..||..   ||...:| .|.:.::.:..||.::........|.:..
  Rat   411 CRTPCNLTRYNKELSMVKIPSKTSA---KYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKK 472

  Fly   445 VMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYCTYRLYINYQLQK 489
            ......||.|:||...|.:|.|:::::|.|.|.       |:|.|
  Rat   473 AYEVAALLGDIGGQMGLFIGASLLTILELFDYI-------YELIK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 94/464 (20%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 110/538 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.