DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and Asic4

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_036020902.1 Gene:Asic4 / 241118 MGIID:2652846 Length:586 Species:Mus musculus


Alignment Length:537 Identity:112/537 - (20%)
Similarity:194/537 - (36%) Gaps:127/537 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RKRGKDPSLIRTA-------ILATFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSI 78
            ::.|.:.||:..|       .||||   ...:.:.|:........:||.|.:|:..||..|...:
Mouse    21 KEAGDEQSLLGAAQGPAAPRDLATF---ASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFL 82

  Fly    79 YLTLLLWLKFYSYPILNTISNDLSITDVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVI 143
            |....|...:.:.|.|..:..........||.||:|:        ::|:           ....:
Mouse    83 YQAASLARGYLTRPHLVAMDPAAPAPVAGFPAVTLCN--------INRF-----------RHSAL 128

  Fly   144 AGFDFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRC-FWGHTEFQCN 207
            :..|..:........|...|.:||  |.||.....:.:..........|.:|.| |.||   .|:
Mouse   129 SDADIFHLANLTGLPPKDRDGHRA--AGLRYPEPDMVDILNRTGHQLADMLKSCNFSGH---HCS 188

  Fly   208 QSHEYLSFIPTTAYLGPCCSFNYNPRNASFVPFSANIFGMDGGLTF-----------VGAEGSER 261
            .|:..:.:   |.| |.|.:||.:|:  |.:|..|.  ||..||..           :..|.:|.
Mouse   189 ASNFSVVY---TRY-GKCYTFNADPQ--SSLPSRAG--GMGSGLEIMLDIQQEEYLPIWRETNET 245

  Fly   262 NLNTGLIVLVHHPMD--YVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRDCLISGDL 324
            :...|:.|.:|...:  |:.:....|:...|:        .|......:..|.:...:|....:|
Mouse   246 SFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQT--------FVSCQEQRLTYLPQPWGNCRAESEL 302

  Fly   325 Q------LSNYRQAACLLACQTEAIVKKCGCH------PYLLPIVG--------NKFKECNLNDT 369
            :      .|.|..:||.|.|:.||::::|.|.      .:|.|:.|        ::.:.|  ..|
Mouse   303 REPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGGHLQPVFGATLLSSRTSRRQRC--MRT 365

  Fly   370 FCYSANYDNFKSVRCDQ----------CLPN----CYDVTYSTLS--------YKTDLNQHKY-- 410
            .| :..|.:.:.:.|..          |.||    |.|.|..:|.        ..|..|..:|  
Mouse   366 TC-TRIYTHERVLMCMSGYLHMGNETICPPNIYIECADHTLDSLGGGSEGPCFCPTPCNLTRYGK 429

  Fly   411 ----------SVSRFYSPELLNNDSF------VLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIF 459
                      ..:|:.:.:...|:::      ||.|:........:.:........||.||||..
Mouse   430 EISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQM 494

  Fly   460 NLCLGLSMISVVEFFYY 476
            .|.:|.|:::::|...|
Mouse   495 GLFIGASILTLLEILDY 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 93/464 (20%)
Asic4XP_036020902.1 ASC 40..535 CDD:413546 108/518 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.