DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and asic-1

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_491214.3 Gene:asic-1 / 191422 WormBaseID:WBGene00022815 Length:823 Species:Caenorhabditis elegans


Alignment Length:446 Identity:101/446 - (22%)
Similarity:167/446 - (37%) Gaps:103/446 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SNDLSITD--VAF----PGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVIAGFDFLNAFTDQS 156
            :||.|:.|  |.|    |..|: ||.|...|             |.|.|....|.....|...::
 Worm   414 TNDTSLDDRVVKFWDIQPSTTM-SPIVKKKE-------------ERDKAYGYTGVKDRIALRAKA 464

  Fly   157 FEPPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAY 221
            .|    :...|.||   |.....|:    :|....|::.:|.:...|  ||..|:::.::..|  
 Worm   465 ME----NMIFAVDA---LTEEEKWK----ISYNKSDFIMKCSFNGRE--CNVKHDFVEYLDPT-- 514

  Fly   222 LGPCCSFNYNPRNASFVPFSANIFGMDGGLTFVGAEGSERN---LNTGLIVLVHHPMDYVTEAAA 283
            .|.|  |.|..:                    :|...:||:   ....|.|.|:......|..||
 Worm   515 YGAC--FTYGQK--------------------LGNNTNERSGPAYGLRLEVFVNVTEYLPTTEAA 557

  Fly   284 SVTITAQS---ESFVEV----SPT--VQSSSVE---VLELSERKRDCLISGDLQLSNYRQAA--- 333
            .|.:|..:   :.|.:.    :||  |.|..::   ::.|.....||:..|..:...|.|.|   
 Worm   558 GVRLTVHATDEQPFPDTLGFSAPTGFVSSFGIKLKSMVRLPAPYGDCVREGKTEDFIYTQKAYNT 622

  Fly   334 --CLLACQTEAIVKKCGC-----HPYLLPIVGNKFKECNLNDTF---C-----YSANYDNFK-SV 382
              |..:|..:.:.|.|||     .||      .:.|.|.::|.:   |     :.|..|:.| ..
 Worm   623 EGCQRSCIQKHLSKTCGCGDPRFPPY------RESKNCPVDDPYKRECIKNEMHVATRDSKKLGC 681

  Fly   383 RCDQ-CLPNCYDVTYSTLSYKT---DLNQHKYSVSRFYSPELLNNDSFVLRVYLAKQVVPVIRKV 443
            .|.| |..:.|.|:||...:..   ||:.....::..:..........::.||..:.....:.:.
 Worm   682 SCKQPCNQDVYSVSYSASRWPAIAGDLSGCPLGMAAHHCLNYKREQGSMIEVYFEQLNYESLLES 746

  Fly   444 TVMSWIGLLSDLGGIFNLCLGLSMISV--VEFFYYCTYRLYINYQLQKVQQPRKAW 497
            ....|..||||.||...|.:|:|:|::  |..|::..:...|:....|.:..||::
 Worm   747 EAYGWSNLLSDFGGQLGLWMGVSVITIGEVACFFFEVFISLISSNRTKRRPARKSF 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 97/423 (23%)
asic-1NP_491214.3 deg-1 16..779 CDD:273309 96/421 (23%)
ASC 17..>104 CDD:279230
ASC <469..788 CDD:295594 79/357 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.