DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and egas-3

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:457 Identity:90/457 - (19%)
Similarity:156/457 - (34%) Gaps:160/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SVLLQLLLLSIY----LTLLLWLKFYSYPILNTISNDL-----SITDVAFPGVTICSPKVVNSER 123
            :||::.:|::||    ||::            |:.|||     .|.|:    |...:..:.:|||
 Worm   565 NVLIKDVLMAIYGHVDLTMI------------TLLNDLMQNPSQIKDM----VPFITGLLTDSER 613

  Fly   124 VDRYVKTLKIPKEYDMAEVIAGFDFLNAFTDQSFEPPGHDSYRATDAVLRLNNVSIWEAAMAVSP 188
            .|         ..:|..::   |::: ||.||..: ...|.::..|.|                 
 Worm   614 SD---------LSWDAGDL---FNWI-AFEDQRLD-LNRDIHKWNDVV----------------- 647

  Fly   189 GCFDYVKRCFWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFNYNPRNASFV---PFSANIFGMDGG 250
                                             ||.|.:||:..||.:::   |      |..||
 Worm   648 ---------------------------------LGNCFTFNHRDRNFTYLMRRP------GRHGG 673

  Fly   251 L-TFVGAEGSERN--LNTGLI-VLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSS----SVE 307
            : .|:.....|..  .:|..| |.:|:..|||  .:.||...||        |..||:    ...
 Worm   674 IQAFMKTRQDEYAPWYDTAAINVFIHNRDDYV--FSESVRYNAQ--------PNAQSTINIFMTR 728

  Fly   308 VLELSERKRDCLISGDLQLSN------YRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKECNL 366
            ...|......| |....::.|      |....||..|..:.:.::|.|.....|...|. ..|.|
 Worm   729 YTRLGGNYGKC-IKKPSEVKNYYYPGAYTTDGCLRTCYQDRMKEECNCMDPRYPQAPNS-TSCQL 791

  Fly   367 NDTFCY------SANYDNFKSVRCD-QCLPNCYDVTYSTLSY-------------KTDLNQHKYS 411
            ::..|.      :.:...:.|..|. .|....|.||:|..::             .|...|:|  
 Worm   792 SERSCVTEASEAAGDPSTWSSCVCPLPCSNQEYSVTWSKANFVNLPITCEKSSDVATCQKQYK-- 854

  Fly   412 VSRFYSPELLNNDSFVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVE--FF 474
                        |..::.:.|.:....:..:...|.:...||.|||...:.:|:::::.:|  |.
 Worm   855 ------------DQLMVSIILPQLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFL 907

  Fly   475 YY 476
            ::
 Worm   908 FF 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 83/434 (19%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 61/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.