DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and degt-1

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:511 Identity:103/511 - (20%)
Similarity:177/511 - (34%) Gaps:137/511 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YTERTKVSGM-WLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDLSIT 104
            :.|.|.:.|. :|..|.:|:  .|.:|..|::..:.|:.|........::....|.|..:..::.
 Worm    44 FAEDTSMLGFRYLHTRYKTW--FRVLWGFVVVFFIGLTFYQVFERVTYYFIKNPLTTRRSYETLP 106

  Fly   105 DVAFPGVTICSPKVVNSERVDRYVKTLKIPKEYD----MAEVI-------AGFDFLNAFTDQSFE 158
            ::.||.:.:|:...:.:..|        ..|..|    |..|:       :.||.|:.|.|....
 Worm   107 NMYFPTIGVCNKMQIKASSV--------ASKNPDLLRGMCSVLDESSSNSSRFDELDKFDDVDIL 163

  Fly   159 PPGHDSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRCFWGHTEF-QCNQSHEYLSFIPTTAYL 222
            ....:|:::.|.:.    ||   .....|..|.|.::..:   |.| .|      .|..|....|
 Worm   164 SLYRNSFQSADDLF----VS---CEFGKSGSCQDEIRPIY---TPFGLC------YSVSPNKTIL 212

  Fly   223 GPCCSFNYNPRNASFVPFSANIFGMDGGLTFVGAEGSERNLNTGLIVLVHHPMDYVTEAAASVTI 287
            .|      .|.....:..:..:..:..|.  |...|...::..|...|.|:......||...|||
 Worm   213 RP------GPETTLSLVLNLEVHEIIPGT--VVEPGVVLSIYDGASSLSHYSEGIHLEAGKVVTI 269

  Fly   288 TAQSESFVEVSPTVQSSSVEVLELSERKRDCLISGDLQLSN-----YRQAACLLACQTEAIVKKC 347
            ...                ||.:|...:..|   |..::.:     |.:|||..:...:.|.|:|
 Worm   270 PVN----------------EVRKLRLHESSC---GSTKMESFSEKEYSKAACEWSVSVKQIEKEC 315

  Fly   348 GCHPYLLPIVGNKFKECN---LNDTFCYSANYDNFK-----------SVRCDQ------------ 386
            ||.|...||....|...|   .|.|......|..:|           .:.|.|            
 Worm   316 GCIPIRNPIYRGVFDNKNDPLNNSTEIPKKKYKKWKKRNIPRCTLRQEIECVQEKLNIRPHIDDS 380

  Fly   387 -CLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNND------------SFVLRVYLAKQVVP 438
             |..:|.|:::|::.:     ..|.|.|...|  :|.:|            ..||.| :..:::|
 Worm   381 ICPDDCDDISFSSIVF-----GGKLSSSEIVS--MLPSDWEDTKEKRVADYQKVLEV-IPNKMIP 437

  Fly   439 VIRKVTVMS-----WIGLLSDLGGIFN-----LCLGLSMISVVEFFYYCTYRLYIN 484
            |:|.|..::     ::...|::.|:.:     .||.|.         ..||..:||
 Worm   438 VVRNVQQLADELQLFVKEASEIFGVSDNFHDVKCLSLD---------GRTYESFIN 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 88/456 (19%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 65/326 (20%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.