DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and del-7

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_501276.4 Gene:del-7 / 183498 WormBaseID:WBGene00016699 Length:614 Species:Caenorhabditis elegans


Alignment Length:522 Identity:104/522 - (19%)
Similarity:187/522 - (35%) Gaps:156/522 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EYTERTKVSG-------MWLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLL-W--------LKF 88
            :|.|..|::.       :||   ...:|||.|:.|:.|:..:..:|.:.... |        ||.
 Worm    46 QYEEALKIAQFHCNCKYLWL---RELHGLSAFMMSNSLMSKVFWAIVIMACAGWSIGNTISILKQ 107

  Fly    89 YSYPILNTISNDLSITDVAFPGVTIC--SPKVVNSERV--DRY--VKTLKIPKEYDMAE-VIAGF 146
            |......|:...|....:.||.:..|  :|..:|...|  |.|  :..::....:.:.: .:.||
 Worm   108 YGDEATTTLLTILPTKQLKFPTMIFCPRNPDFLNYYNVLEDMYNHLGYMENTTNFHILQYAMTGF 172

  Fly   147 DFLNAFTD---QSFEPPGH----------DSYRATDAVLRLNNVSIWEAAMAVSPGCFDYVKRCF 198
            .|.||..|   :::....|          ..|...|.:...|..:           |.|..:.|:
 Worm   173 GFDNANGDTFNETYREQIHIYYLKWRGERTQYEMFDFMFNKNGYT-----------CTDLFQTCY 226

  Fly   199 WGHTEFQCNQSHEYLSFIPTTAYLGPCC-----SFNYNPRN--ASFVPFSANIFGMDGGLTFVGA 256
            .|...:.|..     .|.||.|.|...|     |:..|..:  |....|..|:            
 Worm   227 GGSQTYNCCD-----IFQPTYAMLRGRCFRLIDSYYQNDTDEVAKLSIFFNNM------------ 274

  Fly   257 EGSERNLNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVS--PTVQSSSVEVLELSERKRDCL 319
              :...||||::..:               :....:|.||:.  |                |..|
 Worm   275 --TSPILNTGVLPQL---------------VLYNGDSNVEIGIYP----------------RYYL 306

  Fly   320 ISGDLQLSNYRQAACLL-----ACQTEAIVK---KCGCHPYLLPIVGNKFKECNLNDTFCYSANY 376
            .|.|.....:.|.:.:|     .|.|:.|.:   .|..:.:|:.::  :...|.: ..:.|:.:|
 Worm   307 NSNDWNRVRFYQKSMILLPKSDGCSTDPIYQGKFTCFVYKWLMQLI--EQYNCTV-PYYKYTLSY 368

  Fly   377 -------------DNFKSVRCDQCLPNCYDVTYSTLSYK--TDLNQHKYSVSRFYSPELLNNDSF 426
                         :||:::          .:|.||:.||  :..::.:.:|:...|.:...:.|:
 Worm   369 LKDVPICEPDVIVNNFENI----------SLTPSTIGYKCTSACSRIENTVTLATSIDTDPDPSY 423

  Fly   427 VLRV-----YLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFF---YYCTYRLYI 483
            :.|:     ||..:....||   ..|..|.:|:|||...|.:|.|::|.|:.|   :...|::..
 Worm   424 MFRIEASFTYLEYEQYKEIR---TTSTAGFISELGGQAGLFVGSSVMSFVQLFNSVFIQIYKILR 485

  Fly   484 NY 485
            ||
 Worm   486 NY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 89/458 (19%)
del-7NP_501276.4 ASC <434..473 CDD:295594 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.