DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and delm-2

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_491296.1 Gene:delm-2 / 182851 WormBaseID:WBGene00016063 Length:608 Species:Caenorhabditis elegans


Alignment Length:501 Identity:104/501 - (20%)
Similarity:186/501 - (37%) Gaps:113/501 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YTERTKVSGMWLMRRNRTYGLSRFIWSSVLLQLLLLSIYLTLLLWLKFYSYPILNTISNDLSITD 105
            :.|.|.:.|...:.:.:.:  :...|..::...:.|.|....:|...:.|.|:::.:|..::...
 Worm    68 FCETTTMHGPKRIFQGKRW--ATLFWLIMVCTSIGLLITQVCILASNYLSKPVVSDVSFLINEEG 130

  Fly   106 VAFPGVTICSPKVVNSERVDRYVKTLKIPKEYDMAEVIAGFDFLNAFTDQSFEPP---GHDSYRA 167
            :.||.:|||:...:....|:...||.:|..  :|...|     ::.||    |.|   |..:::.
 Worm   131 IQFPQITICNFTPIRKTFVNEMNKTGQISP--NMINYI-----MHWFT----EVPILIGSSNWQL 184

  Fly   168 TD------AVLRLNNVSIWEAAMAVSPG--CFDYVKRC-FWGHTEFQCNQSHEYLSFIPTTAYLG 223
            ..      ...:.||.:.......:..|  |.|..|.| |.|.|...|:.|      .|....||
 Worm   185 LHEGNKDLQEYQKNNPNFTVQGFFIDAGFSCSDIFKLCSFQGETFDCCSIS------TPVLTPLG 243

  Fly   224 PCCSFNY------------NPRNASFVPFSANIFGMDGGLT----------FVGAEGSE----RN 262
            .|.:.:.            .|             |:..||.          |.|:.|.:    .:
 Worm   244 KCYTLDLLSSTKPSMHKQTEP-------------GIQAGLAITLDAHLEEQFDGSNGMDALFTNS 295

  Fly   263 LNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRDCL------IS 321
            ...|....||.|......::...|:|..|.::..:|    |...|:|. :.:..:|.      |.
 Worm   296 FVNGFQYFVHPPNTIPHLSSDEFTVTPNSVAYTAIS----SERFELLP-TNKWGNCTEHYPSGIK 355

  Fly   322 GDLQLSNYRQAACLLACQTEAIVKKCGCHPYLLPIVGNK--FKECNLNDTFCYSANYD------- 377
            .||.   |....|:..|:.:..::.|||.|   .:..|:  .|||...:|.....|::       
 Worm   356 SDLP---YLTGNCVSLCKAKFFMENCGCTP---AVYNNERNLKECTPFETLACVNNHNGSNNATG 414

  Fly   378 --NFKSVRCDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDSFVL-RVYLAKQVVPV 439
              .||..||.||...|.::.|.  ::.:..||..   :|.:.....||.::.: .:....|::.:
 Worm   415 KLEFKLPRCAQCAQQCNNLIYR--AFNSQGNQFS---ARAFEWFRTNNSNWTMAHIKTNFQIIHI 474

  Fly   440 I---------RKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYY 476
            .         .:|...|...|||::||...:.||:|:|::.|...|
 Worm   475 FYQDMSNTEYNQVQDASISDLLSNIGGNMGMFLGMSLITITEICLY 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 96/455 (21%)
delm-2NP_491296.1 ASC 68..520 CDD:279230 103/499 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.