DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk6 and mec-4

DIOPT Version :9

Sequence 1:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:348 Identity:82/348 - (23%)
Similarity:139/348 - (39%) Gaps:75/348 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DYVKRC-FWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFNYNPRNASFVPFSANIFGMDGGLTFVG 255
            :.|.:| |.|..   |:...::|:.|...  .|.|.:||:|.        :.|:..:..|..:  
 Worm   445 ELVHKCSFNGKA---CDIEADFLTHIDPA--FGSCFTFNHNR--------TVNLTSIRAGPMY-- 494

  Fly   256 AEGSERNLNTGLIVLVH-HPMDYV-TEAAASVTITAQS-------ESFVEVSPTVQSSSVEVLEL 311
                      ||.:||: :..||: |..|..|.:|...       ::|...:||...||.. |.|
 Worm   495 ----------GLRMLVYVNASDYMPTTEATGVRLTIHDKEDFPFPDTFGYSAPTGYVSSFG-LRL 548

  Fly   312 SERKR------DCLISG---DLQLSNYRQA--ACLLACQTEAIVKKCGCHPYLLPIVGNKFKECN 365
            .:..|      ||:..|   |...|||..:  .|..:|..:.::|:|.|.....|:..|. :.|:
 Worm   549 RKMSRLPAPYGDCVPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRCGDPRFPVPENA-RHCD 612

  Fly   366 LNDTF---CYSANYDNFKSV------RCDQ-CLPNCYDVTYS-----TLSYKTDL---NQHKYSV 412
            ..|..   |..|..::...:      ||.| |..:.|.||||     :||.:..|   |......
 Worm   613 AADPIARKCLDARMNDLGGLHGSFRCRCQQPCRQSIYSVTYSPAKWPSLSLQIQLGSCNGTAVEC 677

  Fly   413 SRFYSPELLNNDSFVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVVEFFYYC 477
            ::.|     ..:..::.|:..:....::.:.....::.||:|.||...|..|:|.::..||.:..
 Worm   678 NKHY-----KENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGGQLGLWCGISFLTCCEFVFLF 737

  Fly   478 TYRLYI----NYQLQKVQQPRKA 496
            ....|:    ||.|.|.::..||
 Worm   738 LETAYMSAEHNYSLYKKKKAEKA 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk6NP_611461.3 ASC 85..476 CDD:279230 75/322 (23%)
mec-4NP_510712.2 deg-1 86..736 CDD:273309 75/322 (23%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 75/325 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.