DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacl and AAE3

DIOPT Version :9

Sequence 1:NP_611460.1 Gene:Hacl / 37285 FlyBaseID:FBgn0034488 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_190468.1 Gene:AAE3 / 824060 AraportID:AT3G48990 Length:514 Species:Arabidopsis thaliana


Alignment Length:380 Identity:75/380 - (19%)
Similarity:119/380 - (31%) Gaps:137/380 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GIPVIELSMAFQAAGLKYIGMRNEQAACYAAQAIGYLTGKPGVCLVVSGPGLLHVTGGMAN---- 87
            |:|:.:|::|.....:|               |:..||......:|:.   |.||.|.:|.    
plant   179 GVPLTQLNLASSVKNIK---------------AVYKLTESDSTVIVLP---LFHVHGLLAGLLSS 225

  Fly    88 ---------------AQVNCWPLIVIGGATNQDHEGIGGFQECPQV-------ELSRPYCKYA-- 128
                           :....||.:....||        .:...|.:       ..|.|..:|.  
plant   226 LGAGAAVTLPAAGRFSATTFWPDMKKYNAT--------WYTAVPTIHQIILDRHASHPETEYPKL 282

  Fly   129 --ARPATAALIPL---HVEKAVRYATYGRPGVAYLDFPGNILQSKAQEASIYKALAHPAPPLAYP 188
              .|..:|:|.|:   .:|:|     :|.|          :|::.|...:.:...::|.|...  
plant   283 RFIRSCSASLAPVILSRLEEA-----FGAP----------VLEAYAMTEATHLMSSNPLPEEG-- 330

  Fly   189 PHDDVIRAAKLLRQAKRPLVIVGKGSAYAHAENTLRHFIENTNLPFLPTPMGKGVVSDTAPQCVS 253
            ||..        ....:|   ||:..|..:.:..::.            |..||.|....|....
plant   331 PHKP--------GSVGKP---VGQEMAILNEKGEIQE------------PNNKGEVCIRGPNVTK 372

  Fly   254 SAR-TLALQKADVVLLLGARLNWILHFGKAPRYDKD-----VKFIQVDIN-------PEEL---- 301
            ..: .....||      |....| .|.|....:|.|     |..|:..||       |.|:    
plant   373 GYKNNPEANKA------GFEFGW-FHTGDIGYFDTDGYLHLVGRIKELINRGGEKISPIEVDAVL 430

  Fly   302 --HNSVVASVAIQADIRPFAEQLFEQMN-AVNFRFG---YEQDWWKQLAVKCKQN 350
              |..|...||....    .|:..|::| ||..|.|   .|:|    :...||:|
plant   431 LTHPDVSQGVAFGVP----DEKYGEEINCAVIPREGTTVTEED----IKAFCKKN 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaclNP_611460.1 PRK09259 8..552 CDD:236433 75/380 (20%)
TPP_PYR_POX_like 8..161 CDD:132918 30/166 (18%)
TPP_enzyme_M 195..322 CDD:278628 28/145 (19%)
TPP_BZL_OCoD_HPCL 367..550 CDD:238962
AAE3NP_190468.1 FACL_fum10p_like 18..508 CDD:341249 75/380 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330201at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.