DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efhc1.2 and CG32086

DIOPT Version :10

Sequence 1:NP_611459.1 Gene:Efhc1.2 / 37284 FlyBaseID:FBgn0034487 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_729720.1 Gene:CG32086 / 326195 FlyBaseID:FBgn0052086 Length:491 Species:Drosophila melanogaster


Alignment Length:312 Identity:60/312 - (19%)
Similarity:95/312 - (30%) Gaps:123/312 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YDKQVLCFNAYF-KENLTEIYHAPYQVRK-------------VKIFFYLEDGTMQVTEPKVENSG 133
            :||.::..|.|| .|.:...|..|:. ||             :|:...||:|     |..::..|
  Fly   156 HDKYIISHNHYFPSEQVNRRYAQPFD-RKSPCGDIHTHGDFGLKVKRCLEEG-----ENHLKVIG 214

  Fly   134 IPQGCLVHRQRIPKAPPTDREFISIFDLNVDTDVQIFDRVYHISGCDVFTRQFLNRAGIFVPEAQ 198
            ..|...:.|...|......:...::.|:.....::        |..||  :..||..        
  Fly   215 KAQVDFMDRNEAPLGMRNKKYTFAVPDITFGVPLR--------SNGDV--KMLLNNI-------- 261

  Fly   199 QEPCDPTTEI--------RKR---------------SGLKQTGNTATSALPKKHAFAQFLEFDR- 239
             |||..|..:        :||               |.|:::....|..||    .|:.||..| 
  Fly   262 -EPCYKTNRLLDAIRYLNKKRHSLRNQLEFHKYALNSVLERSDTDGTGHLP----LARILEIFRS 321

  Fly   240 -----------------RVLKFQGYWNDRSEF----------------------GDVRKLEVCYY 265
                             |::..:|...:|..:                      .||..|:..|.
  Fly   322 FHIRLDAQKIRLALSNFRLIVDEGCATERVNYVDFFRLLSIQNSLPKTGNLTNVSDVSCLDTTYR 386

  Fly   266 LADDTIDIKEKFPRNSGR-----EGPTTFLK----------RGKLPKEFSGL 302
            |.  ..|::.|...|:|.     ||..|..|          ||....:|:.|
  Fly   387 LL--CADLQNKSKDNTGAISQNLEGNKTTAKDLITPDLAILRGLTHSDFTCL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Efhc1.2NP_611459.1 DM10 84..191 CDD:128921 25/120 (21%)
DM10_dom 231..368 CDD:461948 24/127 (19%)
DM10 440..547 CDD:128921
CG32086NP_729720.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.