DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Efhc1.2 and CG33490

DIOPT Version :9

Sequence 1:NP_611459.1 Gene:Efhc1.2 / 37284 FlyBaseID:FBgn0034487 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_996047.1 Gene:CG33490 / 2768970 FlyBaseID:FBgn0053490 Length:530 Species:Drosophila melanogaster


Alignment Length:547 Identity:94/547 - (17%)
Similarity:168/547 - (30%) Gaps:182/547 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 IRKRSGLKQTGNTATSALPKKHAFAQFLEFDRRVLKFQGYWNDRSEFGDVRKLEVCYYLADDTID 272
            |.:..|::..|.|:|                   ::|.|             .:.|.::.....:
  Fly     8 IERNPGIRAAGLTST-------------------VQFNG-------------AKDCLFVVSLEEE 40

  Fly   273 IKEKFPRNSGREGPTTFLKRGKLPKEFSGLPL----PGQQTAMTLLNVLGNSMRDVRYVADPLNT 333
            .:::......|..|....:..|||....|..|    ||      |...|.|..|:..:...|   
  Fly    41 AEDRIRALCRRSRPKPAKRTPKLPTHQIGDILNNENPG------LFAELQNKFRENMFHKKP--- 96

  Fly   334 GQKEVQHYTDQDLQIGAVLNVFGR-----------SVVL--TSCDQFTQSY--YREKYGIQE--- 380
            |..|.:....:...:..:.:.||:           |:||  .|.:|..:.|  |.:|:.|..   
  Fly    97 GLGEARETNSKPSYVTNLSHTFGKITQSNCNDSLYSIVLPPKSAEQVNREYGEYHDKHIISHNHY 161

  Fly   381 FSPQPIPER------------------------------------------SDIRPYTQGGMGSR 403
            |..:.|..|                                          .||...|:|.:|.:
  Fly   162 FPAEQINRRYSKPFNRFNTFGLPPTLDPSGIKMKHCLEEGEEHLKIVKKPQKDIDDRTKGPLGKK 226

  Fly   404 RLPPYNGWGSHEDSEGNCITVEPKPPQADFKKLFKYDGCILRFGAKLISAI------------RD 456
                |: |..::..| |.......|.:.|.:.|.:|....:: ..||..|:            ||
  Fly   227 ----YS-WYPYQIPE-NMTFGRTLPRETDVRSLLEYTSPSIK-SEKLAIAVSHLNMLRKMLQERD 284

  Fly   457 NGERDFVISYFLADDT-----LQIYETSRRNSGFLGGEFLKRARVPLPGQDMYS----------- 505
            :...:.|||.....||     |.:.|..         ..|.:..:|...:.:.:           
  Fly   285 DFNMNQVISALGKKDTEGQRQLPLDEVI---------NVLHKLSIPADAEKIRNAASHFQLFVDE 340

  Fly   506 ---SSRPEYYRANDF--------YIGRTMTL------KDHIFHIVSADEFTLMYMEQHPSEFPVA 553
               |.:.:|....|.        .||....:      :|..:..:.||   ||.......:|..|
  Fly   341 GCCSEKVKYEELCDLLSILKSLPLIGSITPMPKVTYNQDTAYRQLCAD---LMKKPPEGPQFKTA 402

  Fly   554 DIQKIMQKIREAVRPDYKQFVLRCKPDGDLGDYTAVSFETLRSTLLSYLSKDC----LLNHEIVT 614
            ....|.|.:..|...|:.. ..:...:.|:.:..:..::|.:.|.:.....|.    ::|.|..|
  Fly   403 KKASIKQDMNAAPFKDFNS-PQKAPIEQDMDETRSRDYKTSQKTPIQQDMDDTRVGDVINPEFST 466

  Fly   615 VCRFFSAEQAMPPSCDRNRVRAAAQLE 641
            :|..:       || |...:|:..::|
  Fly   467 LCGLW-------PS-DFKALRSKDEIE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Efhc1.2NP_611459.1 DM10 84..191 CDD:128921
DUF1126 112..144 CDD:284078
DM10 238..376 CDD:128921 28/156 (18%)
DUF1126 262..294 CDD:284078 3/31 (10%)
DM10 440..547 CDD:128921 24/151 (16%)
DUF1126 463..495 CDD:284078 8/36 (22%)
CG33490NP_996047.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12086
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.