DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG34429

DIOPT Version :10

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:85 Identity:27/85 - (31%)
Similarity:42/85 - (49%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 NGSACLDRLICENGQV--DEHSGLYAQLLHRLLRPHQTLDV-------RYLDAYRMGRHGVDCRN 189
            ||..|:.:.|||:...  |:.:||..::||.||.|..::|.       .||.|.|:|..|.||..
  Fly   157 NGRVCVLKSICESAAAPFDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQ 221

  Fly   190 AFPEAHHCILDDYLHLHERG 209
            .:|.....:|:.:..:|..|
  Fly   222 VYPRCPKSLLEHFSDVHHLG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 25/78 (32%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 25/75 (33%)

Return to query results.
Submit another query.