DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG34443

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:226 Identity:56/226 - (24%)
Similarity:81/226 - (35%) Gaps:81/226 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FTLEAVSALEANLTSWRHHRRQKRFLIYQNGGV--------------IKFVSGCAFPAPFMEKKA 62
            :..||...|.||...|         .|:|||.:              .|..:||.......|.:|
  Fly    54 YNFEANYNLPANWEKW---------TIFQNGPIESEEVVDETDTETDRKLAAGCQNCTVKEENEA 109

  Fly    63 WRQLVWLMNFHYQFNE--PQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAE 125
            ..:.|      .:..|  ||           .|.::..||:    |...|:.||:          
  Fly   110 GSEEV------EEITEVLPQ-----------ERKVRSLLTR----SNIYRIFVDK---------- 143

  Fly   126 AYMNQLGQNGSACLDRLICEN--GQVDEHSGLYAQLLHRLLRP----HQTLDVRYLDAYRMGRHG 184
              :.:.|..|.:||.|||||.  .|:||.:|:...|:|.|..|    .:.|.:||..|...|.:|
  Fly   144 --LKRSGFRGESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRYYQAEHDGWNG 206

  Fly   185 VDCRNAFPEAHHCILDDYLHLHERGPKQSFL 215
                       ||      |::|.|..:|.|
  Fly   207 -----------HC------HVYEPGCGESIL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 26/95 (27%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.