DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG5768

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:220 Identity:51/220 - (23%)
Similarity:87/220 - (39%) Gaps:41/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SALEANLTS-------W-RHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHY 74
            |:.|:.:||       | |...|.||:|.:..|.  .|.....|....:....:....:.:|:..
  Fly   195 SSPESLVTSSHLLHRRWQRALSRPKRYLSFPEGS--SFSVAVCFTVGIIGNPYYGYNSFGLNWGV 257

  Fly    75 QFNEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQNGSACL 139
            .::.|.|.   |.|    ::|.|..|.|..|:|..|    ..:..:::..||.::.:|.||..|:
  Fly   258 AYDLPNTT---WVL----QHLHGFATHPVAPAVLRR----RSRSAIYRQIEAVVDNMGYNGRDCI 311

  Fly   140 DRLICENGQVDEHSGLYAQLLHRLLRP--------------HQTLD-VRYLDAYRMGRHGVDCRN 189
            .|.:||:.|..:.:.:  .::..:||.              |:..| |.|..||| ..|..||..
  Fly   312 LRTLCESRQYFQRTKM--SMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYR-NAHTDDCTQ 373

  Fly   190 AFPEAHHCILDDYLHLHERGPKQSF 214
            .  ..|..:|:.....:...||..:
  Fly   374 Y--NCHFSLLELAFGKYTTPPKNYY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 24/104 (23%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.