DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG17780

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:197 Identity:42/197 - (21%)
Similarity:69/197 - (35%) Gaps:60/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ANLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWR----QLVWLMNFHYQF------ 76
            |:..|.|..||.||:|.:..|                .:.:||    ..:|.:|..|.:      
  Fly    66 ASGNSTRILRRGKRYLQFSKG----------------SRMSWRTNGKNNLWTINTLYAYGYGFRA 114

  Fly    77 NEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQNGSACLDR 141
            |.|...|.               .|....:|..||...:    ||...|..::..|.:|.||:.:
  Fly   115 NYPFPSIE---------------EQKKDNAVFFRLFKRD----LFSKLETALDGHGFDGRACMLK 160

  Fly   142 LICEN-GQVD---EHSGLYAQLLHRLLRPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILDDY 202
            ..|.. ..||   :.||:..::|..:.|..:    ||||.       ::....|......|::.|
  Fly   161 SFCTAINDVDNPKQKSGMLFKMLKLIFRRAK----RYLDI-------IETTRIFVGIFQVIVNTY 214

  Fly   203 LH 204
            ::
  Fly   215 IN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 21/93 (23%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 13/55 (24%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.