DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG13613

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster


Alignment Length:198 Identity:45/198 - (22%)
Similarity:71/198 - (35%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LIYQNGGVIKFVSGCAFPAP-------FMEKKAWRQLVWLMNFHYQFNEPQT--PIYWWKLW--D 90
            |::....|::..|..:.||.       ||:          |.|...:|.|.|  ..|...:|  :
  Fly    30 LLFPTSTVLQLTSSISIPADLNTRTKVFMD----------MGFQMNYNLPPTVSAFYNATIWADE 84

  Fly    91 GSRNLKGPLTQPAPPSV----------PARLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICE 145
            .||..|..|......::          ||.....:    |:|..|..:...|.:.| ||.|.:||
  Fly    85 LSRRQKRQLDHSLDANLQQYDLEGGMHPADFTAGQ----LYKGIENMLETYGFHRS-CLLRSVCE 144

  Fly   146 NG----QVDEHSGLYAQLLHRLLRPHQ-----TLDVRYLDAY----RMGRHGVDCRNAFPEAHHC 197
            ..    ..|...|:..|::..||.|.|     ..:..|.|.|    ::|..|..|..::|.....
  Fly   145 LALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYPSCQAD 209

  Fly   198 ILD 200
            |::
  Fly   210 IIN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 25/100 (25%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.