DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13869 and CG17784

DIOPT Version :9

Sequence 1:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:218 Identity:58/218 - (26%)
Similarity:95/218 - (43%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IILFLFTLEAVSALEANL----------------------TSWRHHRRQKRFLIYQNGGVIKFVS 49
            ::..|||::.|.:...|:                      :|.....|.||..||...||:|.|.
  Fly    12 LLSLLFTIDLVLSFTKNIYTSDESFLRISRSINHPDESDNSSLTSLSRSKRVAIYNGQGVVKLVP 76

  Fly    50 GCAFPAPFMEKKA--WRQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLL 112
            ..|:|....:|:.  |    |..|...|:.....|:|||..|:.:..:.  ..:.....:.|::|
  Fly    77 SLAYPVKQTDKEQSFW----WFFNLQGQWIPTTIPLYWWSFWNTTAFVS--TAREWRKDMQAKVL 135

  Fly   113 VDEPQLLLFKFAEAYMNQL-GQNGSACLDRLICENGQVD-EHSGLYAQLLHRLLRPHQTLD---V 172
            .||.:..::...|..|.|| |..|..||.|.|||..|.. ::|.:::::::.:|.|  |||   .
  Fly   136 HDEARTWVYNAIEVGMEQLDGAYGGVCLLRSICEISQKPFQNSNIFSEIVNAVLVP--TLDNVAS 198

  Fly   173 RYLDAYRMGRHGVDCRNAFPEAH 195
            :||.|...||.|.||...:.:.:
  Fly   199 KYLHARDAGRGGADCERTYSDCN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 29/87 (33%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449135
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.