DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11099 and RLP16

DIOPT Version :9

Sequence 1:	NP_001286627.1	Gene:	CG11099 / 37282	FlyBaseID:	FBgn0034485	Length:	378	Species:	Drosophila melanogaster
Sequence 2:	NP_001321481.1	Gene:	RLP16 / 843760	AraportID:	AT1G74200	Length:	302	Species:	Arabidopsis thaliana

Alignment Length:	131	Identity:	38/131 - (29%)
Similarity:	64/131 - (48%)	Gaps:	11/131 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 DVPMDLFLYEDLEEVYLKENFIS-VIPKWLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVS 78
            :||:.||....|:.:.|..|.:| .:|:.:.....||.:.|..||||.:..|..:.:|:..||:.
plant   132 EVPISLFNMSSLQLLALSANSLSGDLPQAISGYGALKVLLLRDNNLSGVIPDTLLGKNIIVLDLR 196

  Fly    79 NNELKELPPTLGLLLNLQQLNV---SGNQLT-ELPVELSGLRNLEHLNIGKNQFRRLPVQLSECV 139
            ||.|....|.   .:|.|.:.:   .||.|| .:|..|..:|::..|::..|   :|...:..|:
plant   197 NNRLSGNIPE---FINTQYIRILLLRGNNLTGSIPRRLCAVRSIHLLDLANN---KLNGSIPSCL 255

  Fly   140 R 140
            |
plant   256 R 256

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11099	NP_001286627.1	leucine-rich repeat	4..25	CDD:275380	4/9 (44%)
		LRR_8	26..82	CDD:290566	18/56 (32%)
		leucine-rich repeat	26..48	CDD:275380	5/22 (23%)
		LRR	<43..>194	CDD:227223	29/102 (28%)
		LRR_4	47..87	CDD:289563	14/39 (36%)
		leucine-rich repeat	49..71	CDD:275380	8/21 (38%)
		leucine-rich repeat	72..95	CDD:275380	6/22 (27%)
		leucine-rich repeat	96..117	CDD:275380	7/24 (29%)
		leucine-rich repeat	118..140	CDD:275380	4/21 (19%)
		leucine-rich repeat	141..164	CDD:275380	38/131 (29%)
RLP16	NP_001321481.1	leucine-rich repeat	2..21	CDD:275380
		PLN00113	12..>255	CDD:331614	36/128 (28%)
		leucine-rich repeat	25..46	CDD:275380
		leucine-rich repeat	47..70	CDD:275380
		leucine-rich repeat	71..94	CDD:275380
		leucine-rich repeat	95..118	CDD:275380
		leucine-rich repeat	119..142	CDD:275380	4/9 (44%)
		leucine-rich repeat	143..166	CDD:275380	5/22 (23%)
		leucine-rich repeat	167..189	CDD:275380	8/21 (38%)
		leucine-rich repeat	190..212	CDD:275380	7/24 (29%)
		leucine-rich repeat	213..236	CDD:275380	6/22 (27%)
		leucine-rich repeat	237..257	CDD:275380	5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000