DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and AT1G13910

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_172844.1 Gene:AT1G13910 / 837950 AraportID:AT1G13910 Length:330 Species:Arabidopsis thaliana


Alignment Length:225 Identity:58/225 - (25%)
Similarity:101/225 - (44%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EVYLKENFISVIPKWLLNITTLKFIHLAGNNLS-ELPVDIYMLENLEFLDVSNNELKE-LPPTLG 90
            ||| ..:.:...||.:..:..|..:.:..|.|: .:|.:|..|:.|..|::..|:|:: |||.:|
plant    83 EVY-SMSIVGNFPKAITKLLDLTVLDMHNNKLTGPIPPEIGRLKRLITLNLRWNKLQQALPPEIG 146

  Fly    91 LLLNLQQLNVSGNQLT-ELPVELSGLRNLEHLNIGKNQFR-RLPVQLSECVRLNELNVSDNEALV 153
            .|.:|..|.:|.|... |:|.||:.|..|::|:|.:|.|. |:|.:|....:|..|:..:|..:.
plant   147 GLKSLTYLYLSFNNFKGEIPKELANLHELQYLHIQENHFTGRIPAELGTLQKLRHLDAGNNNLVG 211

  Fly   154 HI---------------------------PERISNLPMLQSLAADRCALVYL---------PAAL 182
            .|                           |.:::||..|:        ::||         ||||
plant   212 SISDLFRIEGCFPALRNLFLNNNYLTGGLPNKLANLTNLE--------ILYLSFNKMTGAIPAAL 268

  Fly   183 SKF--MNHVRIFHNTAINYIPMVYERFYQN 210
            :..  :.::.:.||.....||   |.||::
plant   269 ASIPRLTNLHLDHNLFNGSIP---EAFYKH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380
LRR_8 26..82 CDD:290566 14/54 (26%)
leucine-rich repeat 26..48 CDD:275380 5/19 (26%)
LRR <43..>194 CDD:227223 46/192 (24%)
LRR_4 47..87 CDD:289563 11/41 (27%)
leucine-rich repeat 49..71 CDD:275380 6/22 (27%)
leucine-rich repeat 72..95 CDD:275380 9/23 (39%)
leucine-rich repeat 96..117 CDD:275380 8/21 (38%)
leucine-rich repeat 118..140 CDD:275380 8/22 (36%)
leucine-rich repeat 141..164 CDD:275380 7/49 (14%)
AT1G13910NP_172844.1 PLN00113 89..>298 CDD:215061 55/218 (25%)
leucine-rich repeat 103..126 CDD:275380 6/22 (27%)
leucine-rich repeat 127..150 CDD:275380 9/22 (41%)
leucine-rich repeat 151..174 CDD:275380 9/22 (41%)
leucine-rich repeat 175..198 CDD:275380 8/22 (36%)
leucine-rich repeat 199..225 CDD:275380 4/25 (16%)
leucine-rich repeat 226..249 CDD:275380 3/22 (14%)
leucine-rich repeat 250..273 CDD:275380 7/30 (23%)
leucine-rich repeat 274..297 CDD:275380 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.