Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_172844.1 | Gene: | AT1G13910 / 837950 | AraportID: | AT1G13910 | Length: | 330 | Species: | Arabidopsis thaliana |
Alignment Length: | 225 | Identity: | 58/225 - (25%) |
---|---|---|---|
Similarity: | 101/225 - (44%) | Gaps: | 54/225 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 EVYLKENFISVIPKWLLNITTLKFIHLAGNNLS-ELPVDIYMLENLEFLDVSNNELKE-LPPTLG 90
Fly 91 LLLNLQQLNVSGNQLT-ELPVELSGLRNLEHLNIGKNQFR-RLPVQLSECVRLNELNVSDNEALV 153
Fly 154 HI---------------------------PERISNLPMLQSLAADRCALVYL---------PAAL 182
Fly 183 SKF--MNHVRIFHNTAINYIPMVYERFYQN 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | |
LRR_8 | 26..82 | CDD:290566 | 14/54 (26%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 5/19 (26%) | ||
LRR | <43..>194 | CDD:227223 | 46/192 (24%) | ||
LRR_4 | 47..87 | CDD:289563 | 11/41 (27%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 7/49 (14%) | ||
AT1G13910 | NP_172844.1 | PLN00113 | 89..>298 | CDD:215061 | 55/218 (25%) |
leucine-rich repeat | 103..126 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 127..150 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 151..174 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 175..198 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 199..225 | CDD:275380 | 4/25 (16%) | ||
leucine-rich repeat | 226..249 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 250..273 | CDD:275380 | 7/30 (23%) | ||
leucine-rich repeat | 274..297 | CDD:275380 | 7/25 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |