Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_199786.2 | Gene: | AT5G49750 / 835038 | AraportID: | AT5G49750 | Length: | 493 | Species: | Arabidopsis thaliana |
Alignment Length: | 227 | Identity: | 55/227 - (24%) |
---|---|---|---|
Similarity: | 97/227 - (42%) | Gaps: | 31/227 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 NKTILHWSYLNFK---DVPMDLFLYEDLEEVYLKENFIS-VIPKWLLNITTLKFIHLAGNNLSEL 62
Fly 63 PVDIYMLENLEFLDVSNN--ELKELPPTLGLLLNLQQLNVSGNQLT-ELPVELSGLRNLEHLNI- 123
Fly 124 ----------GKNQFRRLPVQLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYL 178
Fly 179 PAALSKFMNHVRIFHNTAINYIPMVYERFYQN 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | 5/23 (22%) |
LRR_8 | 26..82 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 8/22 (36%) | ||
LRR | <43..>194 | CDD:227223 | 40/164 (24%) | ||
LRR_4 | 47..87 | CDD:289563 | 13/41 (32%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 5/32 (16%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 5/22 (23%) | ||
AT5G49750 | NP_199786.2 | PLN00113 | 113..>466 | CDD:215061 | 50/202 (25%) |
leucine-rich repeat | 148..172 | CDD:275380 | |||
leucine-rich repeat | 173..196 | CDD:275380 | |||
leucine-rich repeat | 197..220 | CDD:275380 | |||
leucine-rich repeat | 221..251 | CDD:275380 | |||
leucine-rich repeat | 252..276 | CDD:275380 | 1/1 (100%) | ||
leucine-rich repeat | 277..300 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 325..347 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 348..372 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 373..394 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 397..420 | CDD:275380 | 4/22 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |