Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_196305.1 | Gene: | PGIP2 / 830578 | AraportID: | AT5G06870 | Length: | 330 | Species: | Arabidopsis thaliana |
Alignment Length: | 199 | Identity: | 48/199 - (24%) |
---|---|---|---|
Similarity: | 82/199 - (41%) | Gaps: | 39/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 WLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVS-NNELKELPPTLGLLLNLQQLNVSGNQL 105
Fly 106 T-ELPVELSGLRNLEHLNIGKNQFRRLPVQLSECV-----RLNELNVSDNEALVHIPERISNLPM 164
Fly 165 LQ------SLAADRCALV-------------------YLPAALSKFMNHVRIFHNTAINYIPMVY 204
Fly 205 ERFY 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | |
LRR_8 | 26..82 | CDD:290566 | 12/40 (30%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 1/5 (20%) | ||
LRR | <43..>194 | CDD:227223 | 43/182 (24%) | ||
LRR_4 | 47..87 | CDD:289563 | 11/40 (28%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 6/22 (27%) | ||
PGIP2 | NP_196305.1 | LRRNT_2 | 26..63 | CDD:285463 | |
leucine-rich repeat | 72..95 | CDD:275380 | 48/199 (24%) | ||
leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 145..168 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 169..196 | CDD:275380 | 6/29 (21%) | ||
leucine-rich repeat | 197..216 | CDD:275380 | 6/18 (33%) | ||
leucine-rich repeat | 217..257 | CDD:275380 | 3/39 (8%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |