DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and PGIP2

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_196305.1 Gene:PGIP2 / 830578 AraportID:AT5G06870 Length:330 Species:Arabidopsis thaliana


Alignment Length:199 Identity:48/199 - (24%)
Similarity:82/199 - (41%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 WLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVS-NNELKELPPTLGLLLNLQQLNVSGNQL 105
            :|.::...|..:|.|:    :...|..|:||.||.:| .|....:|..|..|.||:.:::|.|.|
plant    95 YLTSLIFRKLTNLTGH----IQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDL 155

  Fly   106 T-ELPVELSGLRNLEHLNIGKNQFRRLPVQLSECV-----RLNELNVSDNEALVHIPERISNLPM 164
            : .:|..||.||.||:|.:.:|   :|...:.|..     ::..|.:|.|:....||:.:.|...
plant   156 SGSIPSSLSSLRKLEYLELSRN---KLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDF 217

  Fly   165 LQ------SLAADRCALV-------------------YLPAALSKFMNHVRIFHNTAINYIPMVY 204
            .:      .|..|...|.                   .....|:|.:|::.:.||.....||..:
plant   218 YRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEW 282

  Fly   205 ERFY 208
            .:.|
plant   283 SKAY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380
LRR_8 26..82 CDD:290566 12/40 (30%)
leucine-rich repeat 26..48 CDD:275380 1/5 (20%)
LRR <43..>194 CDD:227223 43/182 (24%)
LRR_4 47..87 CDD:289563 11/40 (28%)
leucine-rich repeat 49..71 CDD:275380 5/21 (24%)
leucine-rich repeat 72..95 CDD:275380 8/23 (35%)
leucine-rich repeat 96..117 CDD:275380 7/21 (33%)
leucine-rich repeat 118..140 CDD:275380 6/26 (23%)
leucine-rich repeat 141..164 CDD:275380 6/22 (27%)
PGIP2NP_196305.1 LRRNT_2 26..63 CDD:285463
leucine-rich repeat 72..95 CDD:275380 48/199 (24%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
leucine-rich repeat 145..168 CDD:275380 8/22 (36%)
leucine-rich repeat 169..196 CDD:275380 6/29 (21%)
leucine-rich repeat 197..216 CDD:275380 6/18 (33%)
leucine-rich repeat 217..257 CDD:275380 3/39 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.