DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11099 and PGIP1

DIOPT Version :9

Sequence 1:	NP_001286627.1	Gene:	CG11099 / 37282	FlyBaseID:	FBgn0034485	Length:	378	Species:	Drosophila melanogaster
Sequence 2:	NP_196304.1	Gene:	PGIP1 / 830577	AraportID:	AT5G06860	Length:	330	Species:	Arabidopsis thaliana

Alignment Length:	123	Identity:	38/123 - (30%)
Similarity:	58/123 - (47%)	Gaps:	8/123 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    46 ITTLKFIHLAGNNLSELPV---DIYMLENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLT- 106
            :|.|..  .:|....::|.   |:..||.|.|..:| |....:.||:..|.||:.|.:|...||
plant    72 VTALTI--FSGQISGQIPAEVGDLPYLETLVFRKLS-NLTGTIQPTIAKLKNLRMLRLSWTNLTG 133

  Fly   107 ELPVELSGLRNLEHLNIGKNQFR-RLPVQLSECVRLNELNVSDNEALVHIPERISNLP 163
            .:|..:|.|:|||.|.:..|... .:|..||...::..|.:|.|:....|||...:.|
plant   134 PIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGSIPESFGSFP 191

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11099	NP_001286627.1	leucine-rich repeat	4..25	CDD:275380
		LRR_8	26..82	CDD:290566	11/38 (29%)
		leucine-rich repeat	26..48	CDD:275380	0/1 (0%)
		LRR	<43..>194	CDD:227223	38/123 (31%)
		LRR_4	47..87	CDD:289563	11/42 (26%)
		leucine-rich repeat	49..71	CDD:275380	5/24 (21%)
		leucine-rich repeat	72..95	CDD:275380	7/22 (32%)
		leucine-rich repeat	96..117	CDD:275380	7/21 (33%)
		leucine-rich repeat	118..140	CDD:275380	7/22 (32%)
		leucine-rich repeat	141..164	CDD:275380	7/23 (30%)
PGIP1	NP_196304.1	LRRNT_2	26..63	CDD:285463
		LRR_8	119..179	CDD:290566	20/59 (34%)
		leucine-rich repeat	121..144	CDD:275380	8/22 (36%)
		leucine-rich repeat	145..168	CDD:275380	7/22 (32%)
		leucine-rich repeat	169..193	CDD:275380	7/23 (30%)
		leucine-rich repeat	194..216	CDD:275380
		leucine-rich repeat	217..240	CDD:275380
		leucine-rich repeat	241..262	CDD:275380
		leucine-rich repeat	264..285	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000