Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_192210.1 | Gene: | AT4G03010 / 828113 | AraportID: | AT4G03010 | Length: | 395 | Species: | Arabidopsis thaliana |
Alignment Length: | 230 | Identity: | 58/230 - (25%) |
---|---|---|---|
Similarity: | 98/230 - (42%) | Gaps: | 65/230 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 IPKWLLNITTLKFIHLAGNNLS-ELPVDIYMLENLEFLDVSNNELK-ELPPTLGLL--------- 92
Fly 93 ---LN----------LQQLNVSGNQLTELPVELSGL-RNLEHLNIGKNQ-----FRRLPVQLSEC 138
Fly 139 VRLNELNVSD---NEALVHIPERISNLPMLQSLAADRCALVYLPAALSKFMNHVRIFHNTAINYI 200
Fly 201 PMVYERF----------YQNFYDNRQRNT---PVA 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | |
LRR_8 | 26..82 | CDD:290566 | 13/43 (30%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 1/8 (13%) | ||
LRR | <43..>194 | CDD:227223 | 45/183 (25%) | ||
LRR_4 | 47..87 | CDD:289563 | 13/41 (32%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 12/45 (27%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 9/25 (36%) | ||
AT4G03010 | NP_192210.1 | LRRNT_2 | 28..66 | CDD:285463 | |
leucine-rich repeat | 99..120 | CDD:275380 | 1/6 (17%) | ||
LRR_8 | 121..181 | CDD:290566 | 17/59 (29%) | ||
LRR_RI | <122..259 | CDD:238064 | 40/144 (28%) | ||
leucine-rich repeat | 123..146 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 147..170 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 171..195 | CDD:275380 | 3/23 (13%) | ||
LRR_8 | 192..250 | CDD:290566 | 19/65 (29%) | ||
leucine-rich repeat | 216..239 | CDD:275380 | 8/29 (28%) | ||
leucine-rich repeat | 240..265 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 266..305 | CDD:275380 | 7/48 (15%) | ||
leucine-rich repeat | 306..332 | CDD:275380 | 8/18 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |