DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and AT3G25670

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_189195.1 Gene:AT3G25670 / 822155 AraportID:AT3G25670 Length:475 Species:Arabidopsis thaliana


Alignment Length:195 Identity:51/195 - (26%)
Similarity:86/195 - (44%) Gaps:55/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VYLKENFISVIPKWLLNITTLKFIHLAGN-------------------NLSE------LPVDIYM 68
            |.|:..|...:|..:.|:|.||.:.||||                   ::|.      ||:.:..
plant   169 VVLENGFNGKLPTRICNLTRLKRLVLAGNLFTGTIPDCFNGFKDLLILDMSRNSFSGILPLSVGE 233

  Fly    69 LENLEFLDVSNNELK-ELPPTLGLLLNLQQLNVSGNQ--------------LTELPV-------- 110
            :.:|..||:|||:|: .||..:|.|.||..|::..|:              ||:|.:        
plant   234 MVSLLKLDLSNNQLEGRLPQEIGFLKNLTLLDLRNNRISGGLFENIEKIPSLTDLVLSGNPMGSD 298

  Fly   111 ELSGLR-----NLEHLNIGKNQFR-RLPVQLSECVRLNELNVSDNEALVHIPER-ISNLPMLQSL 168
            ::.|::     ||..|::.|...| .:|:.|:...||..|.::||.....:|.: :..||.|.:|
plant   299 DMMGIKWENMGNLVILDLSKMGLRGEVPLGLTSLRRLRFLGLNDNNLTGTVPSKELETLPCLGAL 363

  Fly   169  168
            plant   364  363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380
LRR_8 26..82 CDD:290566 21/77 (27%)
leucine-rich repeat 26..48 CDD:275380 5/18 (28%)
LRR <43..>194 CDD:227223 47/181 (26%)
LRR_4 47..87 CDD:289563 18/65 (28%)
leucine-rich repeat 49..71 CDD:275380 9/46 (20%)
leucine-rich repeat 72..95 CDD:275380 11/23 (48%)
leucine-rich repeat 96..117 CDD:275380 6/47 (13%)
leucine-rich repeat 118..140 CDD:275380 6/22 (27%)
leucine-rich repeat 141..164 CDD:275380 6/23 (26%)
AT3G25670NP_189195.1 leucine-rich repeat 113..134 CDD:275380
PLN00113 120..>374 CDD:215061 51/195 (26%)
leucine-rich repeat 140..164 CDD:275380
leucine-rich repeat 165..184 CDD:275380 4/14 (29%)
leucine-rich repeat 189..212 CDD:275380 6/22 (27%)
leucine-rich repeat 213..236 CDD:275380 3/22 (14%)
leucine-rich repeat 237..260 CDD:275380 11/22 (50%)
leucine-rich repeat 261..284 CDD:275380 3/22 (14%)
leucine-rich repeat 285..310 CDD:275380 4/24 (17%)
leucine-rich repeat 311..334 CDD:275380 6/22 (27%)
leucine-rich repeat 335..359 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.