DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and AT3G20820

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_188718.1 Gene:AT3G20820 / 821630 AraportID:AT3G20820 Length:365 Species:Arabidopsis thaliana


Alignment Length:241 Identity:63/241 - (26%)
Similarity:112/241 - (46%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IPKWLLNITTLKFIHLAGNNLS-ELPVDIYMLENLEFLDVSNNELK-ELPPTLGLLLNLQQLNVS 101
            |||.:..:..|:.:.|.||.:| .:|.||..|..|..|:|::|.:. .:|.:|..|.:|..|::.
plant   119 IPKCITRLPFLRTLDLIGNQISGGIPYDIGRLNRLAVLNVADNRISGSIPKSLTNLSSLMHLDLR 183

  Fly   102 GNQLT-ELPVELSGLRNLEHLNIGKNQFR-RLPVQLSECVRLNELNVSDNEALVHIPERISNLPM 164
            .|.:: .:|.::..|:.|....:..|:.. |:|..|:...||.::::|.|:....||..:..:.:
plant   184 NNLISGVIPSDVGRLKMLSRALLSGNRITGRIPESLTNIYRLADVDLSGNQLYGTIPPSLGRMSV 248

  Fly   165 LQSLAADRCALV-YLPAAL--SKFMNHVRIFHNTAINYIPMVY-ERFYQNFYDNRQRNT--PVAV 223
            |.:|..|...:. .:|..|  |..|| :.:..|.....||..: .|.|....|....|.  |:..
plant   249 LATLNLDGNKISGEIPQTLMTSSVMN-LNLSRNLLQGKIPEGFGPRSYFTVLDLSYNNLKGPIPR 312

  Fly   224 HRKGLFWVRELETSTRLL---LPVGTRTVFPVPSVENRVSLYDDCL 266
            ...|..::..|:.|...|   :|||:    |...:|....:::|||
plant   313 SISGASFIGHLDLSHNHLCGRIPVGS----PFDHLEAASFMFNDCL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380
LRR_8 26..82 CDD:290566 16/43 (37%)
leucine-rich repeat 26..48 CDD:275380 3/8 (38%)
LRR <43..>194 CDD:227223 40/157 (25%)
LRR_4 47..87 CDD:289563 13/41 (32%)
leucine-rich repeat 49..71 CDD:275380 9/22 (41%)
leucine-rich repeat 72..95 CDD:275380 7/23 (30%)
leucine-rich repeat 96..117 CDD:275380 4/21 (19%)
leucine-rich repeat 118..140 CDD:275380 5/22 (23%)
leucine-rich repeat 141..164 CDD:275380 5/22 (23%)
AT3G20820NP_188718.1 PLN00113 28..>335 CDD:215061 55/216 (25%)
leucine-rich repeat 129..152 CDD:275380 9/22 (41%)
leucine-rich repeat 153..176 CDD:275380 7/22 (32%)
leucine-rich repeat 177..200 CDD:275380 5/22 (23%)
leucine-rich repeat 201..224 CDD:275380 5/22 (23%)
leucine-rich repeat 225..248 CDD:275380 5/22 (23%)
leucine-rich repeat 249..271 CDD:275380 5/21 (24%)
leucine-rich repeat 272..295 CDD:275380 6/23 (26%)
leucine-rich repeat 296..321 CDD:275380 4/24 (17%)
leucine-rich repeat 322..343 CDD:275380 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.