DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and FLR1

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_974291.4 Gene:FLR1 / 820391 AraportID:AT3G12145 Length:325 Species:Arabidopsis thaliana


Alignment Length:251 Identity:55/251 - (21%)
Similarity:107/251 - (42%) Gaps:77/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHWSYLNF--KDVPMDLFLYEDLEEVYLKENFIS-VIPKWLLNITTLKFIHLAGNNLS-ELPVDI 66
            |.:|||..  .::|..:...::|..:|||...:| .||.::..:.:|.|:.|:.|..: .:|..:
plant    95 LDFSYLPHLTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSL 159

  Fly    67 YMLENLEFLDVSNNELK-ELPPTLGLLL-NLQQLNVSGNQLT-ELP----------VELSG---- 114
            ..:..||.:.:::|:|. .:|.:.|..: |:..|.:|.|:|: ::|          |:|||    
plant   160 SQMPKLEAIQINDNKLTGSIPNSFGSFVGNVPNLYLSNNKLSGKIPESLSKYDFNAVDLSGNGFE 224

  Fly   115 ------------------LRNLEHLNIGKNQFRR---------------LPVQLSECVRLNELNV 146
                              .||:.:.::.|.:|.|               :|..|:: :.|...||
plant   225 GDAFMFFGRNKTTVRVDLSRNMFNFDLVKVKFARSIVSLDLSQNHIYGKIPPALTK-LHLEHFNV 288

  Fly   147 SDNEALVHIPERISNLPMLQSLAADRCALVYLPAALSKFMNHVRIFHNTAINYIPM 202
            |||    |:..:|.:..:||:         :.|:|.:         ||..:...|:
plant   289 SDN----HLCGKIPSGGLLQT---------FEPSAFA---------HNICLCGTPL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 5/20 (25%)
LRR_8 26..82 CDD:290566 15/57 (26%)
leucine-rich repeat 26..48 CDD:275380 7/22 (32%)
LRR <43..>194 CDD:227223 40/201 (20%)
LRR_4 47..87 CDD:289563 9/41 (22%)
leucine-rich repeat 49..71 CDD:275380 5/22 (23%)
leucine-rich repeat 72..95 CDD:275380 6/24 (25%)
leucine-rich repeat 96..117 CDD:275380 9/53 (17%)
leucine-rich repeat 118..140 CDD:275380 5/36 (14%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
FLR1NP_974291.4 PLN00113 9..>300 CDD:331614 48/209 (23%)
leucine-rich repeat 92..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..140 CDD:275380 7/22 (32%)
leucine-rich repeat 141..164 CDD:275380 5/22 (23%)
leucine-rich repeat 165..189 CDD:275380 6/23 (26%)
leucine-rich repeat 190..209 CDD:275380 5/18 (28%)
leucine-rich repeat 237..259 CDD:275380 4/21 (19%)
leucine-rich repeat 260..282 CDD:275380 2/22 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.