Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_974291.4 | Gene: | FLR1 / 820391 | AraportID: | AT3G12145 | Length: | 325 | Species: | Arabidopsis thaliana |
Alignment Length: | 251 | Identity: | 55/251 - (21%) |
---|---|---|---|
Similarity: | 107/251 - (42%) | Gaps: | 77/251 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LHWSYLNF--KDVPMDLFLYEDLEEVYLKENFIS-VIPKWLLNITTLKFIHLAGNNLS-ELPVDI 66
Fly 67 YMLENLEFLDVSNNELK-ELPPTLGLLL-NLQQLNVSGNQLT-ELP----------VELSG---- 114
Fly 115 ------------------LRNLEHLNIGKNQFRR---------------LPVQLSECVRLNELNV 146
Fly 147 SDNEALVHIPERISNLPMLQSLAADRCALVYLPAALSKFMNHVRIFHNTAINYIPM 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | 5/20 (25%) |
LRR_8 | 26..82 | CDD:290566 | 15/57 (26%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 7/22 (32%) | ||
LRR | <43..>194 | CDD:227223 | 40/201 (20%) | ||
LRR_4 | 47..87 | CDD:289563 | 9/41 (22%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 9/53 (17%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 5/36 (14%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 8/22 (36%) | ||
FLR1 | NP_974291.4 | PLN00113 | 9..>300 | CDD:331614 | 48/209 (23%) |
leucine-rich repeat | 92..116 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 117..140 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 165..189 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 190..209 | CDD:275380 | 5/18 (28%) | ||
leucine-rich repeat | 237..259 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 260..282 | CDD:275380 | 2/22 (9%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |