DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and RLP29

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_181808.1 Gene:RLP29 / 818880 AraportID:AT2G42800 Length:462 Species:Arabidopsis thaliana


Alignment Length:240 Identity:66/240 - (27%)
Similarity:112/240 - (46%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PMDLFLYEDLEEVYLKEN--FISVIPKWLLNITTLKFIHLAGNNLS-ELPVDIYMLENLEFLDVS 78
            |:.|.....|:::.|:.|  ....||..:.::.:|:.:.|:.|.|: ::|..|:.|::|..||:|
plant   133 PIKLIPNSSLQQLSLRSNPSLSGQIPPRISSLKSLQILTLSQNRLTGDIPPAIFSLKSLVHLDLS 197

  Fly    79 NNELK-ELPPTLGLLLNLQQLNVSGNQLT-ELPVELSGLRNLEHLNIGKNQ-FRRLPVQLSECVR 140
            .|:|. ::|..||.|.||..|::|.|.|| .:|..:|.|..|:.|::..|. |.|:|..:.:...
plant   198 YNKLTGKIPLQLGNLNNLVGLDLSYNSLTGTIPPTISQLGMLQKLDLSSNSLFGRIPEGVEKLRS 262

  Fly   141 LNELNVSDNEALVHIPERISNLPMLQSLAADRCAL-VYLPAAL---------------------- 182
            |:.:.:|:|:.....|:.||||..||....|...: |.||..|                      
plant   263 LSFMALSNNKLKGAFPKGISNLQSLQYFIMDNNPMFVALPVELGFLPKLQELQLENSGYSGVIPE 327

  Fly   183 --SKFMN--HVRIFHNTAINYIPMVYERFYQNFYDNRQRNTPVAV 223
              :|..|  .:.:.:|.....||..:|.....|:.|..||..:.|
plant   328 SYTKLTNLSSLSLANNRLTGEIPSGFESLPHVFHLNLSRNLLIGV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 2/7 (29%)
LRR_8 26..82 CDD:290566 17/58 (29%)
leucine-rich repeat 26..48 CDD:275380 5/23 (22%)
LRR <43..>194 CDD:227223 50/181 (28%)
LRR_4 47..87 CDD:289563 13/41 (32%)
leucine-rich repeat 49..71 CDD:275380 7/22 (32%)
leucine-rich repeat 72..95 CDD:275380 10/23 (43%)
leucine-rich repeat 96..117 CDD:275380 8/21 (38%)
leucine-rich repeat 118..140 CDD:275380 6/22 (27%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
RLP29NP_181808.1 PLN00113 8..>383 CDD:215061 66/240 (28%)
leucine-rich repeat 142..166 CDD:275380 5/23 (22%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
leucine-rich repeat 215..238 CDD:275380 9/22 (41%)
leucine-rich repeat 239..262 CDD:275380 6/22 (27%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
leucine-rich repeat 287..310 CDD:275380 7/22 (32%)
leucine-rich repeat 311..334 CDD:275380 1/22 (5%)
leucine-rich repeat 335..356 CDD:275380 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.