DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and RLP22

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001323933.1 Gene:RLP22 / 817826 AraportID:AT2G32660 Length:771 Species:Arabidopsis thaliana


Alignment Length:243 Identity:60/243 - (24%)
Similarity:101/243 - (41%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HWSYLNFK----------DVPMDLFLYED-----LEEVYLKENFISVIPKWLLNITTLKFIHLAG 56
            :||..:.|          |...|.|:|||     .:.:|:::..:         :|....|..:|
plant   543 NWSVKSLKMYDEERLYMGDYSSDRFVYEDTLDLQYKGLYMEQGKV---------LTFYSAIDFSG 598

  Fly    57 NNL-SELPVDIYMLENLEFLDVSNNELK-ELPPTLGLLLNLQQLNVSGNQLT-ELPVELSGLRNL 118
            |.| .|:|..|.:|:.|..|::|||... .:|.:...:..|:.|::|||:|: |:|.||..|..|
plant   599 NKLEGEIPESIGLLKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSGEIPQELGRLSYL 663

  Fly   119 EHLNIGKNQFRRLPVQLSECVRLNELNVSDNEALVHIPERISNL----PMLQS--------LAAD 171
            .::::..||......|.::.:...:.:...|..|..:|...|.|    |..|.        |...
plant   664 AYIDVSDNQLTGKIPQGTQIIGQPKSSFEGNSGLCGLPLEESCLREDAPSTQEPEEEEEEILEWR 728

  Fly   172 RCALVYLPAALSKFMNHVRIFHNTAINYIPMVYER--FYQNFYDNRQR 217
            ..|:.|.|..|          ...||.::..:|:.  |.:|...||.|
plant   729 AAAIGYGPGVL----------FGLAIGHVVALYKPGWFIKNNGQNRLR 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 7/27 (26%)
LRR_8 26..82 CDD:290566 15/56 (27%)
leucine-rich repeat 26..48 CDD:275380 1/21 (5%)
LRR <43..>194 CDD:227223 42/165 (25%)
LRR_4 47..87 CDD:289563 14/41 (34%)
leucine-rich repeat 49..71 CDD:275380 8/22 (36%)
leucine-rich repeat 72..95 CDD:275380 6/23 (26%)
leucine-rich repeat 96..117 CDD:275380 10/21 (48%)
leucine-rich repeat 118..140 CDD:275380 4/21 (19%)
leucine-rich repeat 141..164 CDD:275380 5/26 (19%)
RLP22NP_001323933.1 PLN00113 87..>699 CDD:215061 42/164 (26%)
leucine-rich repeat 89..113 CDD:275380
leucine-rich repeat 114..137 CDD:275380
leucine-rich repeat 138..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..257 CDD:275380
leucine-rich repeat 258..282 CDD:275380
leucine-rich repeat 283..305 CDD:275380
leucine-rich repeat 306..327 CDD:275380
leucine-rich repeat 330..374 CDD:275380
leucine-rich repeat 375..400 CDD:275380
leucine-rich repeat 401..421 CDD:275380
leucine-rich repeat 422..440 CDD:275380
leucine-rich repeat 446..469 CDD:275380
leucine-rich repeat 470..493 CDD:275380
leucine-rich repeat 494..521 CDD:275380
leucine-rich repeat 522..548 CDD:275380 2/4 (50%)
leucine-rich repeat 549..590 CDD:275380 8/49 (16%)
leucine-rich repeat 591..614 CDD:275380 8/22 (36%)
leucine-rich repeat 615..638 CDD:275380 6/22 (27%)
leucine-rich repeat 639..662 CDD:275380 11/22 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.