Sequence 1: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001311265.1 | Gene: | SHOC2 / 8036 | HGNCID: | 15454 | Length: | 582 | Species: | Homo sapiens |
Alignment Length: | 334 | Identity: | 86/334 - (25%) |
---|---|---|---|
Similarity: | 149/334 - (44%) | Gaps: | 61/334 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVS 78
Fly 79 NNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQLSECVRLNE 143
Fly 144 LNVSDNEALVHIPER-ISNLPMLQSLA-ADRCALVYLPAALSKF--MNHVRIFHNTAINYIPM-V 203
Fly 204 YER----FYQNFYDNRQRNTP-------------VAVHR--------KGLFWVRELETSTRLL-- 241
Fly 242 LPVGTRTV----------FPVPSVENRVSLYDDCLHALQTLNRFTP---------------VYEN 281
Fly 282 VAMHRLLPE 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | 1/10 (10%) |
LRR_8 | 26..82 | CDD:290566 | 19/55 (35%) | ||
leucine-rich repeat | 26..48 | CDD:275380 | 7/21 (33%) | ||
LRR | <43..>194 | CDD:227223 | 46/154 (30%) | ||
LRR_4 | 47..87 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 49..71 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 72..95 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 96..117 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 141..164 | CDD:275380 | 9/23 (39%) | ||
SHOC2 | NP_001311265.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..88 | ||
LRR 1 | 101..122 | ||||
leucine-rich repeat | 104..124 | CDD:275380 | |||
PLN00113 | <115..>483 | CDD:215061 | 79/302 (26%) | ||
LRR 2 | 124..145 | ||||
leucine-rich repeat | 125..147 | CDD:275380 | |||
LRR 3 | 147..169 | ||||
leucine-rich repeat | 148..170 | CDD:275380 | |||
LRR 4 | 170..191 | 1/8 (13%) | |||
leucine-rich repeat | 171..193 | CDD:275380 | 1/10 (10%) | ||
LRR 5 | 193..214 | 6/20 (30%) | |||
leucine-rich repeat | 194..216 | CDD:275380 | 7/21 (33%) | ||
LRR 6 | 216..237 | 5/20 (25%) | |||
leucine-rich repeat | 217..239 | CDD:275380 | 6/21 (29%) | ||
LRR 7 | 239..260 | 10/20 (50%) | |||
leucine-rich repeat | 240..262 | CDD:275380 | 9/21 (43%) | ||
LRR 8 | 262..283 | 5/20 (25%) | |||
leucine-rich repeat | 263..285 | CDD:275380 | 6/21 (29%) | ||
LRR 9 | 285..307 | 5/21 (24%) | |||
leucine-rich repeat | 286..332 | CDD:275380 | 15/46 (33%) | ||
LRR 10 | 308..329 | 7/21 (33%) | |||
LRR 11 | 332..353 | 6/20 (30%) | |||
leucine-rich repeat | 333..380 | CDD:275380 | 15/47 (32%) | ||
LRR 12 | 356..377 | 6/21 (29%) | |||
LRR 13 | 380..400 | 4/19 (21%) | |||
leucine-rich repeat | 381..403 | CDD:275380 | 4/21 (19%) | ||
LRR 14 | 403..424 | 1/20 (5%) | |||
leucine-rich repeat | 404..426 | CDD:275380 | 3/21 (14%) | ||
LRR 15 | 426..448 | 7/21 (33%) | |||
leucine-rich repeat | 427..449 | CDD:275380 | 7/21 (33%) | ||
LRR 16 | 449..470 | 2/20 (10%) | |||
leucine-rich repeat | 450..472 | CDD:275380 | 2/21 (10%) | ||
PLN03150 | <453..527 | CDD:178695 | 12/61 (20%) | ||
LRR 17 | 472..494 | 4/21 (19%) | |||
leucine-rich repeat | 473..495 | CDD:275380 | 3/21 (14%) | ||
LRR 18 | 495..516 | 6/19 (32%) | |||
leucine-rich repeat | 496..519 | CDD:275380 | 6/18 (33%) | ||
LRR 19 | 518..540 | ||||
LRR 20 | 542..563 | ||||
leucine-rich repeat | 543..563 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |