DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and Lrrc2

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006512427.1 Gene:Lrrc2 / 74249 MGIID:1921499 Length:379 Species:Mus musculus


Alignment Length:179 Identity:61/179 - (34%)
Similarity:98/179 - (54%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYML 69
            :...|...:|::|..|.....|:|.|:....|.:||.::.....:|.:.|..|.::.||.:|..|
Mouse   110 VFELSGTQWKELPDSLKEQTHLKEWYIHSTLIQIIPTYIELFQAMKILDLPKNQITCLPAEIGRL 174

  Fly    70 ENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGN-QLTELPVELSGLRNLEHLNIGKNQFRRLPV 133
            :||:.|:||.|.||.:||.||...:|::|:.||| .|.:||.|||.|:.:..::|..|:|..:|:
Mouse   175 KNLKELNVSFNHLKSIPPELGDCEHLERLDCSGNLDLMDLPFELSNLKQVTFVDISANKFSSVPI 239

  Fly   134 QLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPAAL 182
            .:....||..|::|.|. |..:|:.|..|..||.....:..|.|||.|:
Mouse   240 CVLRMCRLQWLDISSNN-LSDLPQDIDRLEELQGFLLYKNKLTYLPQAM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 4/19 (21%)
LRR_8 26..82 CDD:290566 19/55 (35%)
leucine-rich repeat 26..48 CDD:275380 6/21 (29%)
LRR <43..>194 CDD:227223 51/141 (36%)
LRR_4 47..87 CDD:289563 15/39 (38%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 11/22 (50%)
leucine-rich repeat 96..117 CDD:275380 11/21 (52%)
leucine-rich repeat 118..140 CDD:275380 4/21 (19%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
Lrrc2XP_006512427.1 LRR <107..376 CDD:227223 61/179 (34%)
leucine-rich repeat 131..153 CDD:275380 6/21 (29%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
leucine-rich repeat 177..199 CDD:275380 11/21 (52%)
leucine-rich repeat 200..223 CDD:275380 12/22 (55%)
leucine-rich repeat 224..245 CDD:275380 4/20 (20%)
leucine-rich repeat 247..269 CDD:275380 8/22 (36%)
leucine-rich repeat 270..292 CDD:275380 7/18 (39%)
leucine-rich repeat 293..316 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BICG
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.