DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11099 and shoc2

DIOPT Version :9

Sequence 1:	NP_001286627.1	Gene:	CG11099 / 37282	FlyBaseID:	FBgn0034485	Length:	378	Species:	Drosophila melanogaster
Sequence 2:	NP_001038251.1	Gene:	shoc2 / 555476	ZFINID:	ZDB-GENE-050208-523	Length:	561	Species:	Danio rerio

Alignment Length:	176	Identity:	56/176 - (31%)
Similarity:	96/176 - (54%)	Gaps:	5/176 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 SYLNFKD-----VPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYM 68
            |.||.||     :|:|...:..:.|:.|..|.::.||:.:..:.:|:.:.|:.|.|.:||..|..
Zfish   361 SKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGN 425

  Fly    69 LENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPV 133
            |..|..||:..|:|:.||..:..|.:||:|.::.||||.||..:..|.||.:|.:|:|..:.||.
Zfish   426 LRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPE 490

  Fly   134 QLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLP 179
            ::.....|.:|.::||..|..:|..::....|..::.:.|.|.:||
Zfish   491 EIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLP 536

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11099	NP_001286627.1	leucine-rich repeat	4..25	CDD:275380	7/20 (35%)
		LRR_8	26..82	CDD:290566	17/55 (31%)
		leucine-rich repeat	26..48	CDD:275380	5/21 (24%)
		LRR	<43..>194	CDD:227223	44/137 (32%)
		LRR_4	47..87	CDD:289563	14/39 (36%)
		leucine-rich repeat	49..71	CDD:275380	8/21 (38%)
		leucine-rich repeat	72..95	CDD:275380	8/22 (36%)
		leucine-rich repeat	96..117	CDD:275380	9/20 (45%)
		leucine-rich repeat	118..140	CDD:275380	6/21 (29%)
		leucine-rich repeat	141..164	CDD:275380	6/22 (27%)
shoc2	NP_001038251.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..67
		LRR 1	80..101
		leucine-rich repeat	83..103	CDD:275380
		LRR_8	102..160	CDD:290566
		LRR 2	103..124
		leucine-rich repeat	104..126	CDD:275380
		LRR_RI	<124..229	CDD:238064
		LRR 3	126..148
		leucine-rich repeat	127..149	CDD:275380
		LRR 4	149..170
		leucine-rich repeat	150..172	CDD:275380
		LRR_8	171..229	CDD:290566
		LRR 5	172..193
		leucine-rich repeat	173..195	CDD:275380
		LRR 6	195..216
		leucine-rich repeat	196..218	CDD:275380
		LRR 7	218..239
		leucine-rich repeat	219..241	CDD:275380
		LRR 8	241..262
		leucine-rich repeat	242..264	CDD:275380
		LRR 9	264..286
		leucine-rich repeat	265..311	CDD:275380
		LRR_RI	268..483	CDD:238064	42/121 (35%)
		LRR 10	287..308
		LRR 11	311..332
		leucine-rich repeat	312..359	CDD:275380
		leucine-rich repeat	316..335	CDD:275380
		LRR 12	335..356
		LRR 13	359..379		7/17 (41%)
		leucine-rich repeat	360..382	CDD:275380	7/20 (35%)
		LRR_8	381..439	CDD:290566	17/57 (30%)
		LRR 14	382..403		5/20 (25%)
		leucine-rich repeat	383..405	CDD:275380	5/21 (24%)
		LRR 15	405..427		7/21 (33%)
		leucine-rich repeat	406..428	CDD:275380	8/21 (38%)
		LRR_8	427..485	CDD:290566	23/57 (40%)
		LRR 16	428..449		7/20 (35%)
		leucine-rich repeat	429..451	CDD:275380	8/21 (38%)
		LRR 17	451..473		9/21 (43%)
		leucine-rich repeat	452..474	CDD:275380	10/21 (48%)
		LRR 18	474..495		7/20 (35%)
		leucine-rich repeat	475..498	CDD:275380	6/22 (27%)
		LRR 19	497..519		6/21 (29%)
		LRR 20	521..542		5/16 (31%)
		leucine-rich repeat	522..542	CDD:275380	5/15 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	40	1.000	Domainoid score	I12515
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910