DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and Sur-8

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001262665.1 Gene:Sur-8 / 42093 FlyBaseID:FBgn0038504 Length:694 Species:Drosophila melanogaster


Alignment Length:174 Identity:53/174 - (30%)
Similarity:93/174 - (53%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LNFKD-----VPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLE 70
            ||.|:     :|:|:..:.::.|:.|..|.:..:|..::|:..|:.:.|:.|.|.::|..|..|.
  Fly   444 LNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLR 508

  Fly    71 NLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQL 135
            .|..||:..|.::.||..:|||..||:|.:..||:|.||..:..|.||.||::.:|..:.||.::
  Fly   509 KLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEI 573

  Fly   136 SECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLP 179
            .....|..|.::.|..|..:|..::....|:.|..|:|.|..:|
  Fly   574 GSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIP 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 5/18 (28%)
LRR_8 26..82 CDD:290566 16/55 (29%)
leucine-rich repeat 26..48 CDD:275380 5/21 (24%)
LRR <43..>194 CDD:227223 44/137 (32%)
LRR_4 47..87 CDD:289563 12/39 (31%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 9/22 (41%)
leucine-rich repeat 96..117 CDD:275380 8/20 (40%)
leucine-rich repeat 118..140 CDD:275380 6/21 (29%)
leucine-rich repeat 141..164 CDD:275380 5/22 (23%)
Sur-8NP_001262665.1 leucine-rich repeat 163..184 CDD:275380
leucine-rich repeat 185..207 CDD:275380
LRR_RI 204..401 CDD:238064
LRR_8 207..264 CDD:290566
leucine-rich repeat 208..230 CDD:275380
leucine-rich repeat 231..253 CDD:275380
LRR_8 252..310 CDD:290566
leucine-rich repeat 254..276 CDD:275380
leucine-rich repeat 277..299 CDD:275380
LRR_8 299..356 CDD:290566
leucine-rich repeat 300..322 CDD:275380
leucine-rich repeat 323..345 CDD:275380
LRR_8 344..403 CDD:290566
leucine-rich repeat 346..368 CDD:275380
leucine-rich repeat 369..392 CDD:275380
LRR_RI <379..566 CDD:238064 40/121 (33%)
leucine-rich repeat 417..440 CDD:275380
leucine-rich repeat 441..486 CDD:275380 10/41 (24%)
LRR_8 463..520 CDD:290566 16/56 (29%)
leucine-rich repeat 487..507 CDD:275380 6/19 (32%)
leucine-rich repeat 510..532 CDD:275380 9/21 (43%)
LRR_8 532..588 CDD:290566 18/55 (33%)
leucine-rich repeat 556..578 CDD:275380 6/21 (29%)
leucine-rich repeat 603..626 CDD:275380 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.