DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and CG3494

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster


Alignment Length:193 Identity:60/193 - (31%)
Similarity:94/193 - (48%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKTILHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDI 66
            |..||..|.....:|||::|      |...:|         |:||     :.|.||.|.|:|.|:
  Fly    36 NTRILQVSKAQISEVPMEVF------EAAQQE---------LVNI-----VSLDGNRLLEMPKDL 80

  Fly    67 YML-ENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRR 130
            .:| |:|..|.::.|::..:|..:.....|..|::|.|.|.:||:||.|||.|.:|:|..|:||:
  Fly    81 PLLSEHLTQLVLNKNQISFVPTNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQ 145

  Fly   131 LPVQLSECVRLNELNVSDNE--ALVHIPERISNLPMLQSLAADRCALVYLPAALSKFMNHVRI 191
            ||..:.|..||..|:..||:  |:......:..:..|:.|......:..:|..|.|..|.|.:
  Fly   146 LPRCIYELERLETLSAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVEL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 7/20 (35%)
LRR_8 26..82 CDD:290566 17/56 (30%)
leucine-rich repeat 26..48 CDD:275380 5/21 (24%)
LRR <43..>194 CDD:227223 50/152 (33%)
LRR_4 47..87 CDD:289563 12/40 (30%)
leucine-rich repeat 49..71 CDD:275380 8/22 (36%)
leucine-rich repeat 72..95 CDD:275380 4/22 (18%)
leucine-rich repeat 96..117 CDD:275380 10/20 (50%)
leucine-rich repeat 118..140 CDD:275380 9/21 (43%)
leucine-rich repeat 141..164 CDD:275380 5/24 (21%)
CG3494NP_611915.1 LRR <34..>231 CDD:227223 60/193 (31%)
leucine-rich repeat 38..62 CDD:275380 9/38 (24%)
leucine-rich repeat 63..86 CDD:275380 10/27 (37%)
LRR_4 85..124 CDD:289563 10/38 (26%)
leucine-rich repeat 87..109 CDD:275380 4/21 (19%)
leucine-rich repeat 110..133 CDD:275380 12/22 (55%)
leucine-rich repeat 134..155 CDD:275380 8/20 (40%)
leucine-rich repeat 156..181 CDD:275380 5/24 (21%)
leucine-rich repeat 182..204 CDD:275380 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.